DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and CG7166

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:218 Identity:56/218 - (25%)
Similarity:85/218 - (38%) Gaps:38/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 INGDSKLDNNLDSSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWH 123
            |.|...|..|...:.:|.|..   ..|...|.:|.|..|.|||..:....:.|       |:...
  Fly    23 IGGSFILPENDPPTTAPKFLS---RGHLYKVIVGETIELPCKVQNLGSFVLLW-------RKGSS 77

  Fly   124 ILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEA 188
            :|::|....|.|:||.|:     ..:.|||..|:.:|.|.|.||:..... ......::::||..
  Fly    78 VLTAGHLKITRDQRFKIV-----GDYNLQINGVKTQDAGDYICQLGDQEN-RDQVHTVEILVPPT 136

  Fly   189 F--ILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGP---RT 248
            .  :..:|::....|||:.|.|....:|.|.  ::|.|.|               ...||   ..
  Fly   137 LRALPHNGQVTARKGSTVTLECKASGNPVPT--IFWFKKD---------------VFSGPTHLSD 184

  Fly   249 QSRLIIREPQVTDSGNYTCSASN 271
            .|.||:.......:|.|.|||.|
  Fly   185 SSTLILENVDRHHAGTYQCSADN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 25/96 (26%)
Ig_3 193..271 CDD:404760 21/80 (26%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 25/95 (26%)
Ig 56..116 CDD:143165 20/71 (28%)
IG_like 144..221 CDD:214653 22/81 (27%)
IGc2 151..209 CDD:197706 21/74 (28%)
IG_like 232..313 CDD:214653
Ig 242..311 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.