DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and dpr13

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:266 Identity:101/266 - (37%)
Similarity:154/266 - (57%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LDNNLDSSD-----------SPMFEDSELMAHNTTV---QLGGTAFLVCKVSGVDRVGVNWNQIS 115
            ::|:|::::           :||:..:|    |:||   |:|.||.:.|.|..:.. ||    :|
  Fly   153 VENHLEANNGIEGGMESLFGTPMYFGTE----NSTVVTTQIGATAHVPCTVHHIGE-GV----VS 208

  Fly   116 WIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVST--PTGIISHF 178
            |||::|:|:|:.|...|::||||:..|...|..|||||||||.||.|:|||||||  ||.|   |
  Fly   209 WIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSI---F 270

  Fly   179 VNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETT 243
            ::|.||...|.|.|....::..|||:.|.|.:.::....:|::|..::|:||| |..|.|.:.|.
  Fly   271 LHLSVVEARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMINY-DIDRGINVSTE 334

  Fly   244 PGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKTSSADRLT----HI 304
            |..:: |.|.|:..:...|||:||.||||:|||:.|.:.||||.||:.......:.:.|    |:
  Fly   335 PDFQS-SELTIQRTRREHSGNFTCVASNTQPASVLVHIFKGDNPAAMYHGHVGGSTKTTQSQLHM 398

  Fly   305 FRSMLA 310
            ...::|
  Fly   399 IMIIIA 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 50/101 (50%)
Ig_3 193..271 CDD:404760 25/77 (32%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 3/4 (75%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 51/107 (48%)
IG_like 182..262 CDD:214653 41/84 (49%)
IG_like 285..362 CDD:214653 26/78 (33%)
IGc2 292..361 CDD:197706 25/70 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.