DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and dpr20

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:300 Identity:84/300 - (28%)
Similarity:138/300 - (46%) Gaps:54/300 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LATTLEP--DQKSILTDNDWKKLWMRGGINGDSKLD-----------------NNLDSSDSPMFE 78
            |||..||  ::.:.|..|...|:..:..::...|.|                 ::.|....|.||
  Fly   204 LATPTEPARNRSTGLVRNSAVKVDSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFE 268

  Fly    79 DSELM--AHNTTVQLGGTAFLVCKVSGV-DRVGVNWNQISWIRRRD----------WHILSSGAQ 130
            |.:.:  |.|.|||.|.:..|.|::|.: |:.      :||:|...          ..:|:.|..
  Fly   269 DVQRIGQATNLTVQAGSSIHLNCRISLLQDKT------VSWVRHNTQDEGKDNGNALDLLTVGMH 327

  Fly   131 LYTNDERFAI-LHTPGSNMWTLQIKFVQRRDHGMYECQVST-PTGIISHFVNLQVVVPEAFILGS 193
            .||.|:|:.: ...|  |.|.|:|..|::.|..:||||:|| |..:|.  :||.|..|:..|:..
  Fly   328 TYTGDKRYKMEFQYP--NNWRLKITNVKKDDEAIYECQISTHPPRVIQ--INLHVNAPKVMIVDE 388

  Fly   194 -----GELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIET---TPGPRTQS 250
                 .|.:.::.||:.|.|::.........|:|:..|.::||..:|..::::|   ..|  ..|
  Fly   389 VGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDG--ANS 451

  Fly   251 RLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAI 290
            .|.|.:...|||||||||.|..:..:|.|.:..|::.|.:
  Fly   452 TLSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESFAEL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 35/109 (32%)
Ig_3 193..271 CDD:404760 25/85 (29%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 4/4 (100%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 29/94 (31%)
Ig 279..378 CDD:299845 34/108 (31%)
Ig 400..471 CDD:299845 24/72 (33%)
IG_like 402..480 CDD:214653 26/79 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.