DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and CG13506

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:325 Identity:63/325 - (19%)
Similarity:107/325 - (32%) Gaps:129/325 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KSILTDNDWKKLWMRGGINGD-SKLDNN-----LDSSDSPMFEDSELMA---------------- 84
            ::.|.||...| |....:||. |.:||.     ||:.|.....|.:.:|                
  Fly   191 RTYLPDNATIK-WSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHIDV 254

  Fly    85 ----------HNTTVQLGGTAFLVC--KVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDER 137
                      ||...:.|.||.|.|  :...:.|.               :.:..|..|..:| :
  Fly   255 QYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRS---------------YFIKDGKTLQLSD-K 303

  Fly   138 FAI---LHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVD 199
            :::   :|. ..|..||.::.|...|.|.|.|||..                   .:||.|:.|.
  Fly   304 YSLKDSVHN-DHNRTTLIVREVTDSDLGEYLCQVEN-------------------AIGSNEVKVH 348

  Fly   200 MGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTD--- 261
                      :..:|..||:                .|:|:|   |.:.....::|..|:..   
  Fly   349 ----------VSYNPETPQF----------------EDMTVE---GNKVTLHWLVRSHQLLSEAM 384

  Fly   262 -----SGNYTCSA---------SNTEPASIY-----VFVSKGDNMAAISRRKTSSADRLT--HIF 305
                 :|:||.|.         :||:  :|:     :.:|:|...|.:..:.|......:  |:|
  Fly   385 LDYQLTGSYTWSTVQVLETHRHNNTD--NIWKITHQLELSRGVWHARVKTKNTKGWSHFSNDHVF 447

  Fly   306  305
              Fly   448  447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 21/101 (21%)
Ig_3 193..271 CDD:404760 16/94 (17%)
Ig strand B 204..208 CDD:409353 0/3 (0%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 0/3 (0%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653
IGc2 83..146 CDD:197706
IG_like 176..254 CDD:214653 15/63 (24%)
Ig 176..239 CDD:299845 14/48 (29%)
I-set 258..349 CDD:254352 26/136 (19%)
Ig 275..348 CDD:143165 21/108 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.