| Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
| Alignment Length: | 197 | Identity: | 60/197 - (30%) |
|---|---|---|---|
| Similarity: | 83/197 - (42%) | Gaps: | 26/197 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 91 LGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKF 155
Fly 156 VQRRDHGMYECQVSTPT-GIISHFVNLQVVVPEAFILGSGELHV-DMGSTINLVCIIEKSPTPPQ 218
Fly 219 YVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSK 283
Fly 284 GD 285 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 31/92 (34%) |
| Ig_3 | 193..271 | CDD:404760 | 21/78 (27%) | ||
| Ig strand B | 204..208 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 219..223 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 250..254 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 264..269 | CDD:409353 | 2/4 (50%) | ||
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 31/92 (34%) |
| FR1 | 37..50 | CDD:409353 | 3/7 (43%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 60/197 (30%) | ||
| Ig strand B | 44..51 | CDD:409353 | 2/6 (33%) | ||
| CDR1 | 51..59 | CDD:409353 | 1/11 (9%) | ||
| Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
| CDR2 | 67..81 | CDD:409353 | 5/13 (38%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 13/30 (43%) | ||
| Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
| Ig strand E | 94..102 | CDD:409353 | 3/7 (43%) | ||
| Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
| CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
| FR4 | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig strand G | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig_3 | 134..208 | CDD:404760 | 22/85 (26%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 0/5 (0%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 60/197 (30%) | ||
| Ig | 227..318 | CDD:416386 | |||
| Ig strand C | 256..260 | CDD:409353 | |||
| Ig strand E | 286..290 | CDD:409353 | |||
| Ig strand F | 300..305 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||