DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and Lac

DIOPT Version :10

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:197 Identity:60/197 - (30%)
Similarity:83/197 - (42%) Gaps:26/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKF 155
            :|||....|.|    :....:|.:......|...||:|:.|...|.||::.:.|.|:.:.||||.
  Fly    42 IGGTVEFDCSV----QYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKD 102

  Fly   156 VQRRDHGMYECQVSTPT-GIISHFVNLQVVVPEAFILGSGELHV-DMGSTINLVCIIEKSPTPPQ 218
            :|..|.|.|.|||...| ..:|..|.|.|..|......|.:..| ..||.:.:.|.....|||. 
  Fly   103 IQETDAGTYTCQVVISTVHKVSAEVKLSV
RRPPVISDNSTQSVVASEGSEVQMECYASGYPTPT- 166

  Fly   219 YVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSK 283
             :.|::.:..|...||      .|..|    :.|.|:..:..|.|.|.|.|.|.        |||
  Fly   167 -ITWRRENNAILPTDS------ATYVG----NTLRIKSVKKEDRGTYYCVADNG--------VSK 212

  Fly   284 GD 285
            ||
  Fly   213 GD 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG_like 86..183 CDD:214653 31/92 (34%)
Ig strand B 95..99 CDD:409353 0/3 (0%)
Ig strand C 109..117 CDD:409353 1/7 (14%)
Ig strand E 149..153 CDD:409353 1/3 (33%)
Ig strand F 163..168 CDD:409353 2/4 (50%)
Ig strand G 176..179 CDD:409353 1/2 (50%)
Ig_3 195..271 CDD:464046 20/76 (26%)
LacNP_523713.2 IG_like 36..131 CDD:214653 31/92 (34%)
Ig strand B 46..50 CDD:409381 0/3 (0%)
Ig strand C 60..63 CDD:409381 0/2 (0%)
Ig strand E 96..100 CDD:409381 1/3 (33%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 1/2 (50%)
Ig_3 134..208 CDD:464046 22/85 (26%)
Ig 227..318 CDD:472250
Ig strand C 256..260 CDD:409353
Ig strand E 286..290 CDD:409353
Ig strand F 300..305 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.