Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006247755.1 | Gene: | Sdk2 / 360652 | RGDID: | 1310397 | Length: | 2175 | Species: | Rattus norvegicus |
Alignment Length: | 244 | Identity: | 61/244 - (25%) |
---|---|---|---|
Similarity: | 90/244 - (36%) | Gaps: | 45/244 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 NTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGA-QLYTNDERFAILHTPGSNMW 149
Fly 150 TLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSP 214
Fly 215 TPPQYVYWQKNDRLINYVDSRRDITIETTPGPR--TQSRLIIREPQVTDSGNYTCSASNTEPASI 277
Fly 278 YVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLNTVVVRHIFLT 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 28/97 (29%) |
Ig_3 | 193..271 | CDD:404760 | 18/79 (23%) | ||
Ig strand B | 204..208 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 219..223 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 250..254 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 264..269 | CDD:409353 | 3/4 (75%) | ||
Sdk2 | XP_006247755.1 | IG_like | 43..112 | CDD:214653 | |
IGc2 | 43..101 | CDD:197706 | |||
IG_like | 123..206 | CDD:214653 | |||
Ig | 135..191 | CDD:299845 | |||
IG_like | 225..307 | CDD:214653 | |||
IGc2 | 236..289 | CDD:197706 | |||
I-set | 311..400 | CDD:254352 | |||
Ig | 329..397 | CDD:143165 | |||
I-set | 405..495 | CDD:254352 | 28/97 (29%) | ||
Ig | 419..495 | CDD:299845 | 26/91 (29%) | ||
Ig | 505..589 | CDD:299845 | 23/106 (22%) | ||
IG_like | 505..589 | CDD:214653 | 23/106 (22%) | ||
FN3 | 593..684 | CDD:238020 | 8/25 (32%) | ||
FN3 | 696..789 | CDD:238020 | |||
FN3 | 797..893 | CDD:238020 | |||
FN3 | 898..986 | CDD:238020 | |||
FN3 | 996..1090 | CDD:238020 | |||
FN3 | 1102..1197 | CDD:238020 | |||
FN3 | 1204..1293 | CDD:238020 | |||
FN3 | 1304..1397 | CDD:238020 | |||
FN3 | 1403..1487 | CDD:238020 | |||
FN3 | 1506..1619 | CDD:238020 | |||
FN3 | 1629..1722 | CDD:238020 | |||
FN3 | 1727..1808 | CDD:238020 | |||
FN3 | 1840..1919 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |