DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and Sdk2

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_006247755.1 Gene:Sdk2 / 360652 RGDID:1310397 Length:2175 Species:Rattus norvegicus


Alignment Length:244 Identity:61/244 - (25%)
Similarity:90/244 - (36%) Gaps:45/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 NTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGA-QLYTNDERFAILHTPGSNMW 149
            ::||..|.:..|.|:.||..|..:.|       ::...||:||: ||    .||.:|.: ||   
  Rat   413 DSTVIDGMSVVLACETSGAPRPAITW-------QKGERILASGSVQL----PRFTLLES-GS--- 462

  Fly   150 TLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSP 214
             |.|......|.|.|.|..:...|:.....:|.|...........:..|..|:..::||.:...|
  Rat   463 -LLISPTHISDAGTYTCLATNSRGVDEASADLVVWARTRITKPPQDQSVIKGTQASMVCGVTHDP 526

  Fly   215 TPPQYVYWQKNDRLINYVDSRRDITIETTPGPR--TQSRLIIREPQVTDSGNYTCSASNTEPASI 277
            .......|:|:.         ..:.:||.|..|  ....|.|.:....|.|.|||..        
  Rat   527 RVTVRYVWEKDG---------ATLAVETNPRIRLDRNGSLHISQTWSGDIGTYTCRV-------- 574

  Fly   278 YVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLNTVVVRHIFLT 326
               :|.|.|   .||.......:|.|   :...|...|:|:..|.|.||
  Rat   575 ---LSAGGN---DSRNAHLRVRQLPH---APEHPVATLSTMERRAINLT 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 28/97 (29%)
Ig_3 193..271 CDD:404760 18/79 (23%)
Ig strand B 204..208 CDD:409353 0/3 (0%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 3/4 (75%)
Sdk2XP_006247755.1 IG_like 43..112 CDD:214653
IGc2 43..101 CDD:197706
IG_like 123..206 CDD:214653
Ig 135..191 CDD:299845
IG_like 225..307 CDD:214653
IGc2 236..289 CDD:197706
I-set 311..400 CDD:254352
Ig 329..397 CDD:143165
I-set 405..495 CDD:254352 28/97 (29%)
Ig 419..495 CDD:299845 26/91 (29%)
Ig 505..589 CDD:299845 23/106 (22%)
IG_like 505..589 CDD:214653 23/106 (22%)
FN3 593..684 CDD:238020 8/25 (32%)
FN3 696..789 CDD:238020
FN3 797..893 CDD:238020
FN3 898..986 CDD:238020
FN3 996..1090 CDD:238020
FN3 1102..1197 CDD:238020
FN3 1204..1293 CDD:238020
FN3 1304..1397 CDD:238020
FN3 1403..1487 CDD:238020
FN3 1506..1619 CDD:238020
FN3 1629..1722 CDD:238020
FN3 1727..1808 CDD:238020
FN3 1840..1919 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.