DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and LRIT3

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_940908.3 Gene:LRIT3 / 345193 HGNCID:24783 Length:679 Species:Homo sapiens


Alignment Length:255 Identity:50/255 - (19%)
Similarity:82/255 - (32%) Gaps:93/255 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGI----------------------ISHF 178
            :..|.|....:.:.||...|::...|     .||||:|:                      ||..
Human   153 KNLAYLDLSSNRLTTLPPDFLESWTH-----LVSTPSGVLDLSPSRIILGLQDNPWFCDCHISKM 212

  Fly   179 VNLQVVVPEAFIL---------------------------------GSGELHVDMGSTINLVCII 210
            :.|..||..|.:|                                 .:.::...:||.:.|.|..
Human   213 IELSKVVDPAIVLLDPLMTCSEPERLTGILFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDA 277

  Fly   211 EKSPTPPQYVYWQKNDRL-INYVDSRRDITIETTP--GPRTQSRLIIREPQVTDSGNYTCSASN- 271
            ...|||  .:.|.::|.. :||.      .|:.:|  |.| .|.:.:......|:|:|.|.|.| 
Human   278 TGFPTP--QITWTRSDSSPVNYT------VIQESPEEGVR-WSIMSLTGISSKDAGDYKCKAKNL 333

  Fly   272 ----------------TEPASIYVFVSKGD----NMAAISRRKTSSADRLTHIFRSMLAP 311
                            |.|.........||    ::...|.|.||.:...::::.|..:|
Human   334 AGMSEAVVTVTVLGITTTPIPPDTSERTGDHPEWDVQPGSGRSTSVSSASSYLWSSSFSP 393

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 14/68 (21%)
Ig_3 193..271 CDD:404760 21/80 (26%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
LRIT3NP_940908.3 LRR 1 56..79
leucine-rich repeat 59..82 CDD:275378
LRR_8 61..117 CDD:290566
LRR 2 80..103
leucine-rich repeat 83..106 CDD:275378
LRR 3 104..128
LRR_8 105..165 CDD:290566 2/11 (18%)
LRR_4 105..146 CDD:289563
leucine-rich repeat 107..130 CDD:275378
LRR 4 129..151
LRR_4 131..170 CDD:289563 4/16 (25%)