DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and dpr19

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:287 Identity:84/287 - (29%)
Similarity:128/287 - (44%) Gaps:77/287 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 HNTTV--QLGGTAFLVCKVSGVDRVGVNW-NQISWIRRRDWHILSSGAQLYTNDERFAILHTPGS 146
            :||.|  |.||.|.|.|.|.      ||. ..:|||||:|:.:|:.|...:::|:||.:.||...
  Fly    46 NNTRVIAQKGGLAILPCVVK------VNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHM 104

  Fly   147 NMWTLQIKFVQRRDHGMYECQVST-PTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCII 210
            ..|:|:||.|:..|.|.||||:|. ||..|  .:.|::|...|.|..:.|||:|..||:.|.|.:
  Fly   105 GHWSLRIKAVREEDRGFYECQLSIYPTQSI--VIELKIVEAVAEISSAPELHIDETSTLRLECKL 167

  Fly   211 EKSPTPPQYVYWQKNDRLINYVDSRRDITI----ETTP--------GPRTQSR------------ 251
            :::...|.:|:|..:.::||| ||:....:    ::.|        .|..:||            
  Fly   168 KRATENPAFVFWYHDSKMINY-DSQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVL 231

  Fly   252 ----------------------------------------LIIREPQVTDSGNYTCSASNTEPAS 276
                                                    |.:::.....:|||||:.||..|||
  Fly   232 NSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPAS 296

  Fly   277 IYVFVSKGDNMAAISRRKTSSADRLTH 303
            |.|.|.:|:..||:.....|..|..|:
  Fly   297 ITVHVLRGEKTAAMQHANRSILDTETN 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 41/100 (41%)
Ig_3 193..271 CDD:404760 26/141 (18%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 3/55 (5%)
Ig strand F 264..269 CDD:409353 4/4 (100%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 34/82 (41%)
IGc2 55..125 CDD:197706 30/75 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.