DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and DIP-zeta

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:232 Identity:66/232 - (28%)
Similarity:96/232 - (41%) Gaps:37/232 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GGINGDSKLDNNLD-SSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRR 120
            ||.|..:   :||: ..:.|.|.:   ...|.||..|....|.|.|..:...     :::|:...
  Fly    97 GGANVPT---SNLNIVVEEPEFTE---YIENVTVPAGRNVKLGCSVKNLGSY-----KVAWMHFE 150

  Fly   121 DWHILSSGAQLYTNDERFAILHTPGS--NMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQV 183
            ...||:....:.|.:.|.::.|....  ..|.|.|..|...|.|.|.||::|.|. .:.|..|.|
  Fly   151 QSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTA-KTQFGYLNV 214

  Fly   184 VVPEAF--ILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDR---LIN---YVDSRRDITI 240
            |||...  .|.|.::.|..|:.|:|.|....||.|  .:.|:::|.   .||   .|:.....|:
  Fly   215 VVPPNIDDSLSSSDVIVREGANISLRCRASGSPRP--IIKWKRDDNSRIAINKNHIVNEWEGDTL 277

  Fly   241 ETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASI 277
            |.|    ..|||        |.|.|.|.|||..|.::
  Fly   278 EIT----RISRL--------DMGAYLCIASNGVPPTV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 26/98 (27%)
Ig_3 193..271 CDD:404760 25/83 (30%)
Ig strand B 204..208 CDD:409353 2/3 (67%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 3/3 (100%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/101 (27%)
Ig 130..200 CDD:143165 17/74 (23%)
I-set 226..310 CDD:254352 28/91 (31%)
IGc2 233..298 CDD:197706 25/78 (32%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.