DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and DIP-iota

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:213 Identity:60/213 - (28%)
Similarity:95/213 - (44%) Gaps:19/213 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 NNLDSSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQL 131
            :.|::|| |.|...   .:|:||.:|..|.|.|.|.  |.|..   :::|:|.....|||....:
  Fly    24 SELNNSD-PKFSGP---INNSTVPVGRDALLTCVVH--DLVSF---KVAWLRVDTQTILSIQNHV 79

  Fly   132 YTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFI--LGSG 194
            .|.:.|.:|.||. ..:|.|:|:.||..|.|.|.||::|.. :.|....|.||||...:  ..|.
  Fly    80 ITKNHRISISHTE-HRIWQLKIRDVQESDRGWYMCQINTDP-MKSQMGYLDVVVPPDIVDYQTSQ 142

  Fly   195 ELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQV 259
            ::....|..:.|.|.....|.|.  :.|::.:.....:....|..:.:..|    ..|.:.:.|.
  Fly   143 DVVRSTGQNVTLTCSATGVPMPT--ITWRREEATPILISDDGDREVFSVEG----QNLTLWQVQR 201

  Fly   260 TDSGNYTCSASNTEPASI 277
            :..|.|.|.|||..|.::
  Fly   202 SHMGAYLCIASNGVPPTV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 33/96 (34%)
Ig_3 193..271 CDD:404760 15/77 (19%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 32/92 (35%)
Ig 39..122 CDD:299845 31/89 (35%)
Ig 132..213 CDD:299845 16/86 (19%)
IG_like 141..227 CDD:214653 18/85 (21%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.