DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and DIP-theta

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:367 Identity:84/367 - (22%)
Similarity:118/367 - (32%) Gaps:137/367 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NGDSKLD--------NNLDSSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISW 116
            |.|..|:        |.:...|.|.|  .||: .|.||.:...|.|.|.|..:...     :|:|
  Fly   107 NKDELLEDIREDTVVNAIPEKDLPKF--GELL-QNVTVPVSREAVLQCVVDNLQTY-----KIAW 163

  Fly   117 IRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNL 181
            :|.....||:....:.|.:.|.:|.|.. ...|.|:|:.|:..|.|.|.||::|.. :.|....|
  Fly   164 LRVDTQTILTIQNHVITKNHRMSITHAE-KRAWILRIRDVKESDKGWYMCQINTDP-MKSQVGYL 226

  Fly   182 QVVVPEAFI--LGSGELHVDMGSTINLVCIIEKSPTP---------------------------- 216
            .||||...:  ..|.::.:..||.:.|.|....||||                            
  Fly   227 DVVVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFL 291

  Fly   217 ---------------------------------------------------------------PQ 218
                                                                           |:
  Fly   292 TIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPK 356

  Fly   219 YV-YWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVS 282
            .: ||.|||.:|  |...|.:......|.:...||.|.|..:.|.|.|.|.|.|          |
  Fly   357 SINYWMKNDTII--VPGERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKN----------S 409

  Fly   283 KGDNMAAISRRKTSSADRLTHI----FRSMLAPCLLLNTVVV 320
            .||         |..|.:|.||    ..:.:||.:.:|||.|
  Fly   410 LGD---------TDGAIKLYHIPQTTTMTTMAPTVSINTVPV 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 28/96 (29%)
Ig_3 193..271 CDD:404760 28/169 (17%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/4 (25%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 29/99 (29%)
IG_like 137..230 CDD:214653 29/99 (29%)
IG_like 240..324 CDD:214653 9/83 (11%)
IGc2 247..310 CDD:197706 8/62 (13%)
Ig 327..419 CDD:299845 25/112 (22%)
IG_like 343..420 CDD:214653 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.