Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_608822.1 | Gene: | bdl / 33635 | FlyBaseID: | FBgn0028482 | Length: | 719 | Species: | Drosophila melanogaster |
Alignment Length: | 197 | Identity: | 48/197 - (24%) |
---|---|---|---|
Similarity: | 73/197 - (37%) | Gaps: | 44/197 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 NTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWT 150
Fly 151 LQIKFVQRRDHGMYECQVSTPTGII---SHFVNLQ------VVVPEAFILGSGELHVDMGSTINL 206
Fly 207 VCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGP--RTQSRLIIREPQVTDSGNYTCSA 269
Fly 270 SN 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 29/105 (28%) |
Ig_3 | 193..271 | CDD:404760 | 15/79 (19%) | ||
Ig strand B | 204..208 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 219..223 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 250..254 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 264..269 | CDD:409353 | 3/4 (75%) | ||
bdl | NP_608822.1 | IG_like | 42..128 | CDD:214653 | |
Ig | 43..131 | CDD:299845 | |||
I-set | 153..242 | CDD:254352 | 27/97 (28%) | ||
Ig | 157..242 | CDD:299845 | 27/97 (28%) | ||
Ig_2 | 252..337 | CDD:290606 | 19/89 (21%) | ||
IG_like | 260..327 | CDD:214653 | 16/73 (22%) | ||
I-set | 341..428 | CDD:254352 | |||
IGc2 | 356..419 | CDD:197706 | |||
FN3 | 435..524 | CDD:238020 | |||
FN3 | 554..636 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |