DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and bdl

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:197 Identity:48/197 - (24%)
Similarity:73/197 - (37%) Gaps:44/197 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 NTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWT 150
            |.|::.|.|||..|.:...:.     :|.||.  :|..:|.....|.   .|| .:...||    
  Fly   159 NQTIREGQTAFFHCVMKHPEN-----SQASWY--KDGVLLQEVQDLV---RRF-YMGPDGS---- 208

  Fly   151 LQIKFVQRRDHGMYECQVSTPTGII---SHFVNLQ------VVVPEAFILGSGELHVDMGSTINL 206
            |.|......|.|.|||:|....|.:   ..|:|:|      ...||.|:        ..|....|
  Fly   209 LSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFL--------PYGQPAVL 265

  Fly   207 VCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGP--RTQSRLIIREPQVTDSGNYTCSA 269
            .|....:| |.:.:.|:|:..|.:..:         .||.  :....|...:.....:|:|||:.
  Fly   266 DCHFRANP-PLKNLRWEKDGLLFDSYN---------VPGVFYKMNGSLFFAKVDENHAGSYTCTP 320

  Fly   270 SN 271
            .|
  Fly   321 YN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 29/105 (28%)
Ig_3 193..271 CDD:404760 15/79 (19%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 3/4 (75%)
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 27/97 (28%)
Ig 157..242 CDD:299845 27/97 (28%)
Ig_2 252..337 CDD:290606 19/89 (21%)
IG_like 260..327 CDD:214653 16/73 (22%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.