Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005166847.1 | Gene: | itgb4 / 335269 | ZFINID: | ZDB-GENE-030131-7209 | Length: | 1931 | Species: | Danio rerio |
Alignment Length: | 276 | Identity: | 52/276 - (18%) |
---|---|---|---|
Similarity: | 96/276 - (34%) | Gaps: | 91/276 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 KLDNNLDSSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRD------- 121
Fly 122 -----WHILSSGAQ-----LYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPT---- 172
Fly 173 ----------GIISHFVNLQVVVPEAF-ILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKND 226
Fly 227 RLINYVDSRRDITIETTPGPR-TQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAI 290
Fly 291 SR------RKTSSADR 300 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 24/127 (19%) |
Ig_3 | 193..271 | CDD:404760 | 13/78 (17%) | ||
Ig strand B | 204..208 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 219..223 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 250..254 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 264..269 | CDD:409353 | 1/4 (25%) | ||
itgb4 | XP_005166847.1 | Integrin_beta | 37..457 | CDD:278776 | 52/276 (19%) |
EGF_2 | <468..490 | CDD:285248 | |||
EGF_2 | 545..573 | CDD:285248 | |||
Integrin_B_tail | 625..709 | CDD:285239 | |||
Calx-beta | 991..1064 | CDD:295344 | |||
FN3 | 1242..1326 | CDD:238020 | |||
FN3 | 1331..1420 | CDD:238020 | |||
fn3 | 1640..1720 | CDD:278470 | |||
fn3 | 1751..1835 | CDD:278470 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |