DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and dpr2

DIOPT Version :10

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:304 Identity:100/304 - (32%)
Similarity:162/304 - (53%) Gaps:44/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DNDWKKLWMRGGIN------GDSKLDNNLDSSDSPMFEDSEL-------MAHNTTVQLGGTAFLV 98
            |||:..:   ..:|      |:| :|:..::.:.|..|.:..       |..|.|.:.|.||.:.
  Fly    67 DNDYVYI---ASVNRKFPQFGNS-IDDEREAEEQPPEETTYPPPVFDFGMPRNITTRTGHTAAIN 127

  Fly    99 CKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGM 163
            |:   ||.:|.  ..:||||:||.|||::|...||:||||.::.|..|..|||.:|:.|.||.|:
  Fly   128 CR---VDNLGD--KSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGI 187

  Fly   164 YECQVSTPTGIISHF-VNLQVVVPE--AFILGSGELHVDMGSTINLVCIIEKSPTPPQ---YVYW 222
            |||||:|...|...| :|:.|..|:  |.|.|..:|:|.:||::.|.|.:::..|..|   .:||
  Fly   188 YECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYW 252

  Fly   223 QKNDRLIN---------YVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIY 278
            .:...::.         .:|.:| |::|:|...:.||||.|...|:.|:|||||..:..|.||:.
  Fly   253 YRGPYILTPFVAHPNDAAIDLQR-ISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVV 316

  Fly   279 VFVSKGDNMAAISRR---KTSSADRLTHIFRSMLAPCLLLNTVV 319
            |.|...::.||:.:.   :||.:.|.:   |.:|...::.::||
  Fly   317 VNVINDESPAAMQKSRAIRTSGSMRSS---RLVLLLAMVASSVV 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG_like 86..183 CDD:214653 44/97 (45%)
Ig strand B 95..99 CDD:409353 1/3 (33%)
Ig strand C 109..117 CDD:409353 1/7 (14%)
Ig strand E 149..153 CDD:409353 3/3 (100%)
Ig strand F 163..168 CDD:409353 3/4 (75%)
Ig strand G 176..179 CDD:409353 1/3 (33%)
Ig_3 195..271 CDD:464046 27/87 (31%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 43/97 (44%)
Ig strand A' 116..118 CDD:409355 0/1 (0%)
Ig strand B 122..130 CDD:409355 3/10 (30%)
CDR1 130..136 CDD:409355 3/7 (43%)
FR2 137..151 CDD:409355 9/13 (69%)
Ig strand C 137..143 CDD:409355 3/5 (60%)
Ig strand C' 149..153 CDD:409355 1/3 (33%)
CDR2 153..162 CDD:409355 4/8 (50%)
Ig strand D 162..167 CDD:409355 1/4 (25%)
FR3 163..192 CDD:409355 13/28 (46%)
Ig strand E 172..178 CDD:409355 3/5 (60%)
Ig strand F 186..192 CDD:409355 4/5 (80%)
IG_like 220..306 CDD:214653 26/86 (30%)
Ig strand B 231..235 CDD:409353 1/3 (33%)
Ig strand C 261..265 CDD:409353 0/3 (0%)
Ig strand E 289..292 CDD:409353 2/2 (100%)
Ig strand F 302..307 CDD:409353 4/4 (100%)
Ig strand G 310..313 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.