DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and dpr3

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:315 Identity:93/315 - (29%)
Similarity:142/315 - (45%) Gaps:70/315 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RGGINGDSKLDNNLDSSDS-PMFEDSELMAHNTTVQLGGT-AFLVCKVSGV-DRVGVNWNQISWI 117
            |.|...:...|  .|:|.| |:|:..  |..|.|.:.|.| |.:.|:|..: |:      .:|||
  Fly   218 RSGAADEESQD--ADTSQSLPIFDFG--MPRNITGRTGHTEAIIKCRVDSLHDK------SVSWI 272

  Fly   118 RRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVST-PTGIISHFVNL 181
            |:||.|||:.|...||:|:||.:..:..|..|||.:|....:|.|:|||||:| |...::..:|:
  Fly   273 RKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNI 337

  Fly   182 QVVVPE--AFILGSGELHVDMGSTINLVCIIEKSPTPPQY--VYWQKNDRLI------------- 229
            ..:.|:  |.|.|..:||...||.|.|.|:::: |:....  :||.:.:.:|             
  Fly   338 IEISPDAKAVISGPPDLHFKAGSAIILNCLVQQ-PSVKDIGPIYWYRGEHMITPFDADDGQPEIP 401

  Fly   230 ----------------NYVDSRRD--------ITIETTPGPRTQSRLIIREPQVTDSGNYTCSAS 270
                            |.:.|..|        |.:|:..|...:|||.|...|.||:|||||..:
  Fly   402 AGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPT 466

  Fly   271 NTEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLNTVVVRHIFL 325
            ....||:.|.|...:|.||:.              :|...||.|....::.|:.|
  Fly   467 TASSASVLVHVINDENPAAMQ--------------KSGACPCALGPLQLLLHLLL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 38/99 (38%)
Ig_3 193..271 CDD:404760 29/116 (25%)
Ig strand B 204..208 CDD:409353 2/3 (67%)
Ig strand C 219..223 CDD:409353 1/5 (20%)
Ig strand E 250..254 CDD:409353 3/3 (100%)
Ig strand F 264..269 CDD:409353 4/4 (100%)
dpr3NP_001014459.2 Ig 243..330 CDD:299845 37/92 (40%)
IG_like 243..329 CDD:214653 37/91 (41%)
Ig 350..464 CDD:299845 29/114 (25%)
IG_like <441..477 CDD:214653 16/35 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5388
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.