DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and CG33543

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:197 Identity:46/197 - (23%)
Similarity:69/197 - (35%) Gaps:53/197 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 SNMWTLQIKFVQRRDHGMYECQVS-TPTGIISHFVNLQVVVPEAFILGSGELHVDM--------- 200
            :.:..|..:.:...|.|.:.|:|: ...|      |..|.|...| |.|.||.|:.         
  Fly   102 TGLLALVFEHIALEDRGNWTCEVNGNRNG------NRNVNVEREF-LASFELLVNQKISFGKTEQ 159

  Fly   201 ------GSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQV 259
                  |....:.|.:|..|.|.  |.|..|...||        |:.:|...|..:.|.||....
  Fly   160 VQSVREGRDAMVNCFVEGMPAPE--VSWLYNGEYIN--------TVNSTKHNRLSNGLYIRNVSQ 214

  Fly   260 TDSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLN-TVVVRHI 323
            .|:|.|||.|....|.                   .|.:|::|.:.|....|....| |:.|::.
  Fly   215 ADAGEYTCRAMRITPT-------------------FSDSDQITILLRIQHKPHWFFNETLPVQYA 260

  Fly   324 FL 325
            ::
  Fly   261 YV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 7/37 (19%)
Ig_3 193..271 CDD:404760 26/92 (28%)
Ig strand B 204..208 CDD:409353 0/3 (0%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 3/4 (75%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 21/68 (31%)
IG_like 256..336 CDD:214653 1/7 (14%)
IGc2 263..327 CDD:197706 46/197 (23%)
FN3 341..445 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.