Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014458.3 | Gene: | CG33543 / 3346207 | FlyBaseID: | FBgn0053543 | Length: | 468 | Species: | Drosophila melanogaster |
Alignment Length: | 197 | Identity: | 46/197 - (23%) |
---|---|---|---|
Similarity: | 69/197 - (35%) | Gaps: | 53/197 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 146 SNMWTLQIKFVQRRDHGMYECQVS-TPTGIISHFVNLQVVVPEAFILGSGELHVDM--------- 200
Fly 201 ------GSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQV 259
Fly 260 TDSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLN-TVVVRHI 323
Fly 324 FL 325 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 7/37 (19%) |
Ig_3 | 193..271 | CDD:404760 | 26/92 (28%) | ||
Ig strand B | 204..208 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 219..223 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 250..254 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 264..269 | CDD:409353 | 3/4 (75%) | ||
CG33543 | NP_001014458.3 | IGc2 | 165..224 | CDD:197706 | 21/68 (31%) |
IG_like | 256..336 | CDD:214653 | 1/7 (14%) | ||
IGc2 | 263..327 | CDD:197706 | 46/197 (23%) | ||
FN3 | 341..445 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |