DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and dpr4

DIOPT Version :10

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:250 Identity:104/250 - (41%)
Similarity:143/250 - (57%) Gaps:13/250 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 WKKLWMRGGINGDSKLDNNLDSSDS-PMFEDSELMAHNTTVQLGGTAFLVCKVSGV-DRVGVNWN 112
            |..|::..|:.|.....:..::..| |.|::|.  ....|..:|..|.|.|:|..: ||.     
  Fly    19 WLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSS--RREVTATVGQAALLHCRVRNLGDRA----- 76

  Fly   113 QISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISH 177
             :||||:||.|||:.|...||||:||..||:.||:.|||:|...|.||.|.|||||||...|...
  Fly    77 -VSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQG 140

  Fly   178 FVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIET 242
            | .|.|||..|.|||:.||.:..||.|||.|:..:||.||.::||.|..|::|| ..|..|.:.|
  Fly   141 F-RLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNY-SQRGGINVIT 203

  Fly   243 TPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKTSS 297
            ....|| |:|:|.:....||||||||.|:::.||:.|.|..|::.||:....:|:
  Fly   204 ERSTRT-SKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSSA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG_like 86..183 CDD:214653 46/97 (47%)
Ig strand B 95..99 CDD:409353 2/3 (67%)
Ig strand C 109..117 CDD:409353 1/7 (14%)
Ig strand E 149..153 CDD:409353 3/3 (100%)
Ig strand F 163..168 CDD:409353 3/4 (75%)
Ig strand G 176..179 CDD:409353 0/2 (0%)
Ig_3 195..271 CDD:464046 34/75 (45%)
dpr4NP_001014616.2 IG_like 53..145 CDD:214653 46/98 (47%)
Ig strand A' 55..57 CDD:409355 0/1 (0%)
Ig strand B 61..69 CDD:409355 3/7 (43%)
CDR1 69..75 CDD:409355 1/5 (20%)
Ig strand C 76..82 CDD:409355 3/11 (27%)
CDR2 85..101 CDD:409355 8/15 (53%)
Ig strand D 101..106 CDD:409355 2/4 (50%)
FR3 102..131 CDD:409355 15/28 (54%)
Ig strand E 110..117 CDD:409355 3/6 (50%)
Ig strand F 125..132 CDD:409355 5/6 (83%)
IG_like 161..>227 CDD:214653 29/67 (43%)
Ig strand B 166..170 CDD:409353 3/3 (100%)
Ig strand C 181..185 CDD:409353 1/3 (33%)
Ig strand E 206..214 CDD:409353 4/8 (50%)

Return to query results.
Submit another query.