DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and dpr8

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:268 Identity:99/268 - (36%)
Similarity:147/268 - (54%) Gaps:18/268 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MRGGINGDSK-------LDNNLDSSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWN 112
            :.|..:|.||       .|.....:..|.|:.:  :..|.|..:|.|..|.|:|..:..     .
  Fly    15 LAGCTDGASKRFFTDFLQDLPTPGTGGPTFDTT--IGTNITGLVGKTVKLTCRVKNLGN-----R 72

  Fly   113 QISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISH 177
            .:||:|.||.|:|:.|...||:|:||..:|:|.:..|||:|::.||:|.|:||||:|| |..|.|
  Fly    73 TVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQIST-TPPIGH 136

  Fly   178 FVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIET 242
            .|.|.:|.|...|:|..|||::.||||||.||::.:|.||..|.|..|..:||:...|..|::.|
  Fly   137 SVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVT 201

  Fly   243 TPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRS 307
            ..|..|.|||::::....|||.|||:.||..|.|:.|.:..|::.||:   .|.:....|.....
  Fly   202 EKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAAM---HTGNNGNSTASQPP 263

  Fly   308 MLAPCLLL 315
            :|.|.:||
  Fly   264 VLLPLVLL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 41/96 (43%)
Ig_3 193..271 CDD:404760 33/77 (43%)
Ig strand B 204..208 CDD:409353 3/3 (100%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 3/3 (100%)
Ig strand F 264..269 CDD:409353 3/4 (75%)
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 36/85 (42%)
V-set 52..143 CDD:284989 40/96 (42%)
IG_like 153..238 CDD:214653 37/84 (44%)
ig 153..232 CDD:278476 35/78 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.