Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038938277.1 | Gene: | Jaml / 315610 | RGDID: | 1562572 | Length: | 379 | Species: | Rattus norvegicus |
Alignment Length: | 247 | Identity: | 55/247 - (22%) |
---|---|---|---|
Similarity: | 90/247 - (36%) | Gaps: | 73/247 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 VQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHI-----------LSSGAQLYTNDERFA--I 140
Fly 141 LHTPGSNMWTLQIKFVQRRDHGMYECQVSTPT-GIISHFVNLQVVVPEAFILGSGELHVDMGSTI 204
Fly 205 NLVCII----EKSPTPPQYVY----------------------WQKNDRLINYVDSRRDITIETT 243
Fly 244 PGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKT 295 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 25/107 (23%) |
Ig_3 | 193..271 | CDD:404760 | 21/103 (20%) | ||
Ig strand B | 204..208 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 219..223 | CDD:409353 | 0/25 (0%) | ||
Ig strand E | 250..254 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 264..269 | CDD:409353 | 3/4 (75%) | ||
Jaml | XP_038938277.1 | V-set | 33..139 | CDD:400157 | 25/109 (23%) |
FR2 | 58..69 | CDD:409353 | 2/10 (20%) | ||
CDR2 | 70..82 | CDD:409353 | 1/11 (9%) | ||
Ig strand C' | 71..77 | CDD:409353 | 0/5 (0%) | ||
Ig strand C' | 78..82 | CDD:409353 | 1/3 (33%) | ||
FR3 | 87..121 | CDD:409353 | 12/37 (32%) | ||
Ig strand D | 90..96 | CDD:409353 | 1/5 (20%) | ||
Ig strand E | 100..108 | CDD:409353 | 3/11 (27%) | ||
Ig strand F | 115..122 | CDD:409353 | 3/6 (50%) | ||
V-set | 141..253 | CDD:400157 | 28/135 (21%) | ||
Ig strand A' | 144..150 | CDD:409353 | 3/5 (60%) | ||
Ig strand B | 152..162 | CDD:409353 | 2/9 (22%) | ||
CDR1 | 162..169 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 169..176 | CDD:409353 | 1/6 (17%) | ||
FR2 | 170..181 | CDD:409353 | 0/10 (0%) | ||
CDR2 | 182..196 | CDD:409353 | 0/13 (0%) | ||
Ig strand C' | 183..189 | CDD:409353 | 0/5 (0%) | ||
Ig strand C' | 191..196 | CDD:409353 | 0/4 (0%) | ||
FR3 | 204..238 | CDD:409353 | 11/48 (23%) | ||
Ig strand D | 207..213 | CDD:409353 | 2/5 (40%) | ||
Ig strand E | 217..225 | CDD:409353 | 0/7 (0%) | ||
Ig strand F | 232..238 | CDD:409353 | 4/13 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 48 | 1.000 | Inparanoid score | I5388 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |