DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and dpr1

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:263 Identity:97/263 - (36%)
Similarity:145/263 - (55%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFA 139
            |.|:..  :..|.||.:|.|.||.|:   |:|:|.  ..:||||:||.|||::|...||:|:||.
  Fly    53 PYFDFD--VPRNLTVTVGQTGFLHCR---VERLGD--KDVSWIRKRDLHILTAGGTTYTSDQRFQ 110

  Fly   140 ILHTPGSNMWTLQIKFVQRRDHGMYECQVST-PTGIISHFVNLQVVVPEAFILGSGELHVDMGST 203
            :|...||..||||||:.|.||.|:||||::| |...:|:..|  ||..:|.|.|..:|.|..||.
  Fly   111 VLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFN--VVELKAEIFGPSDLMVKTGSD 173

  Fly   204 INLVCIIEKSPTPPQYVYWQKNDRLI-----NYVDS---RRDITIETTPGPRTQSRLIIREPQVT 260
            |||.|.|.:.|.....::|.|...::     |.:||   |..:..:.|.|  ..|||.|:.....
  Fly   174 INLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDG--LTSRLKIKRAMPG 236

  Fly   261 DSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLNTV--VVRHI 323
            |:|||||..:..:.:|:||.|..|::.||:....:|:::.    |...:. |:||:.|  .::|.
  Fly   237 DTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNS----FYCGIC-CMLLSIVSCCLQHF 296

  Fly   324 FLT 326
            :.|
  Fly   297 YET 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 47/97 (48%)
Ig_3 193..271 CDD:404760 28/85 (33%)
Ig strand B 204..208 CDD:409353 3/3 (100%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 3/3 (100%)
Ig strand F 264..269 CDD:409353 4/4 (100%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 47/101 (47%)
IG_like 60..150 CDD:214653 46/94 (49%)
IG_like 163..257 CDD:214653 31/95 (33%)
Ig 174..244 CDD:143165 23/71 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.