DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and dpr9

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:275 Identity:105/275 - (38%)
Similarity:160/275 - (58%) Gaps:23/275 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 NNLDSSDS----PMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSS 127
            |::|..::    |.|:  :..:.|.|..||.||:|.|:|..:....: ..|:||:|.||.|:|:.
  Fly   244 NSIDLEEARNAGPYFD--KAFSKNVTALLGKTAYLNCRVKNLGNKTM-LLQVSWVRHRDIHLLTV 305

  Fly   128 GAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILG 192
            |...||:|:||..:|.|.:..|.||||:.|.||.|:||||||| |..:||:::|.||.|...|:|
  Fly   306 GRYTYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYECQVST-TPHMSHYIHLNVVEPSTEIIG 369

  Fly   193 SGELHVDMGSTINLVCIIEKSPTPPQYVYWQKND------RLINYVDSRRDITIETTPGPRTQSR 251
            :.:|:::.||||||.|||:.||.||.|::|..|:      ::|||...|..:::.|..|..|.|.
  Fly   370 APDLYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKGDTTTSF 434

  Fly   252 LIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAISR--------RKTSSADRLTHIFRSM 308
            |:|:..:.:|||:|.|:.||.:|.|:.|.|..|.: .::||        |.||::..|.|.....
  Fly   435 LLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNGVS-HSVSRGVPSSNAARGTSASSPLAHSLSVC 498

  Fly   309 LAPCLLLNTVVVRHI 323
            :..|:||.....|.|
  Fly   499 VPVCVLLQLGACRWI 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 45/96 (47%)
Ig_3 193..271 CDD:404760 32/83 (39%)
Ig strand B 204..208 CDD:409353 3/3 (100%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 45/99 (45%)
IG_like 263..360 CDD:214653 45/98 (46%)
IG_like 371..464 CDD:214653 37/92 (40%)
IGc2 377..456 CDD:197706 33/78 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.