DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and Lsamp

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:282 Identity:61/282 - (21%)
Similarity:94/282 - (33%) Gaps:102/282 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 NTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWT 150
            |.||:.|.||.|.|.|...:      ::::|:.|..  |:.:|...::.|.|.. |....:..::
Mouse    71 NITVRQGDTAILRCVVEDKN------SKVAWLNRSG--IIFAGHDKWSLDPRVE-LEKRHALEYS 126

  Fly   151 LQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPT 215
            |:|:.|...|.|.|.|.|.|.....:..|.|.|.||......|.::.|:.||.:.|||:....|.
Mouse   127 LRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPE 191

  Fly   216 P-----------------PQYV------------------------------------------- 220
            |                 .:|:                                           
Mouse   192 PVITWRHLTPLGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESK 256

  Fly   221 ------------------------YWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTD 261
                                    .|.::|..||   |...:.|::|.|   ||.|.:.......
Mouse   257 SNEATTGRQASLKCEASAVPAPDFEWYRDDTRIN---SANGLEIKSTEG---QSSLTVTNVTEEH 315

  Fly   262 SGNYTCSASN---TEPASIYVF 280
            .|||||.|:|   ...||:.:|
Mouse   316 YGNYTCVAANKLGVTNASLVLF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 27/96 (28%)
Ig_3 193..271 CDD:404760 27/161 (17%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/70 (1%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 4/4 (100%)
LsampXP_030104997.1 Ig 69..159 CDD:386229 27/96 (28%)
Ig_3 163..232 CDD:372822 10/68 (15%)
Ig_3 250..325 CDD:372822 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.