DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and LRIT1

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_056428.1 Gene:LRIT1 / 26103 HGNCID:23404 Length:623 Species:Homo sapiens


Alignment Length:347 Identity:64/347 - (18%)
Similarity:96/347 - (27%) Gaps:151/347 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWT-LQIK 154
            |||||.|.|..:||....::|      ||.:...|:.......:.:         ...|| |.:.
Human   267 LGGTALLRCGATGVPGPEMSW------RRANGRPLNGTVHQEVSSD---------GTSWTLLGLP 316

  Fly   155 FVQRRDHGMYECQVSTPTGIISHFVNLQVV----------------------------------- 184
            .|...|.|.|.||.....|.....::|.|.                                   
Human   317 AVSHLDSGDYICQAKNFLGASETVISLIVTEPPTSTEHSGSPGALWARTGGGGEAAAYNNKLVAR 381

  Fly   185 ----VPEAFILGSG--------EL---HVDM-------------------------GSTINLVCI 209
                :|:..:|.:|        ||   |..|                         |.|.:.|.:
Human   382 HVPQIPKPAVLATGPSVPSTKEELTLEHFQMDALGELSDGRAGPSEARMVRSVKVVGDTYHSVSL 446

  Fly   210 IEKSPTPPQ--------YVYWQKNDRLINYVDSRRDITIE------------TTPG--PRTQSRL 252
            :.|:|....        .|:.|.:.|.:.....:..:||.            ...|  ||.:..:
Human   447 VWKAPQAKNTTAFSVLYAVFGQHSMRRVIVQPGKTRVTITGLLPKTKYVACVCVQGLVPRKEQCV 511

  Fly   253 IIREPQVTDSGN-----------------------YTCSA-----------SNTEPASIYVFVSK 283
            |....:|.|:.|                       ..|||           .:||....||.:.:
Human   512 IFSTNEVVDAENTQQLINVVVISVAIVIALPLTLLVCCSALQKRCRKCFNKDSTEATVTYVNLER 576

  Fly   284 ----GDNMAAISRRKTSSADRL 301
                .|.:..:||...|.||||
Human   577 LGYSEDGLEELSRHSVSEADRL 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 24/92 (26%)
Ig_3 193..271 CDD:404760 25/169 (15%)
Ig strand B 204..208 CDD:409353 0/3 (0%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 0/3 (0%)
Ig strand F 264..269 CDD:409353 2/27 (7%)
LRIT1NP_056428.1 LRR 1 60..81
leucine-rich repeat 61..84 CDD:275378
LRR_8 63..143 CDD:290566
LRR 2 84..105
leucine-rich repeat 85..132 CDD:275378
LRR 3 108..129
LRR_8 131..202 CDD:290566
LRR_4 131..171 CDD:289563
LRR 4 132..153
leucine-rich repeat 133..156 CDD:275378
LRR 5 156..177
leucine-rich repeat 157..180 CDD:275378
leucine-rich repeat 181..205 CDD:275378
TPKR_C2 201..>240 CDD:301599
Ig 267..345 CDD:299845 24/92 (26%)
IG_like 267..345 CDD:214653 24/92 (26%)
FN3 431..498 CDD:214495 10/66 (15%)
LRR 6. /evidence=ECO:0000305 571..594 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.