Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_058788.1 | Gene: | Tyro3 / 25232 | RGDID: | 3923 | Length: | 880 | Species: | Rattus norvegicus |
Alignment Length: | 197 | Identity: | 46/197 - (23%) |
---|---|---|---|
Similarity: | 68/197 - (34%) | Gaps: | 37/197 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 TVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQ 152
Fly 153 IKFVQRRDHGMYECQVSTPTGI-ISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTP 216
Fly 217 PQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASN------TEPA 275
Fly 276 SI 277 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 26/95 (27%) |
Ig_3 | 193..271 | CDD:404760 | 14/77 (18%) | ||
Ig strand B | 204..208 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 219..223 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 250..254 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 264..269 | CDD:409353 | 1/4 (25%) | ||
Tyro3 | NP_058788.1 | IG_like | 39..125 | CDD:214653 | 26/95 (27%) |
IGc2 | 46..111 | CDD:197706 | 20/78 (26%) | ||
Ig2_Tyro3_like | 131..209 | CDD:143226 | 18/93 (19%) | ||
IG_like | 135..204 | CDD:214653 | 15/84 (18%) | ||
FN3 | 215..307 | CDD:238020 | |||
fn3 | 315..396 | CDD:278470 | |||
PTKc_Tyro3 | 498..781 | CDD:270659 | |||
Pkinase_Tyr | 508..776 | CDD:285015 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 804..827 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 842..864 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |