DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and Tyro3

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_058788.1 Gene:Tyro3 / 25232 RGDID:3923 Length:880 Species:Rattus norvegicus


Alignment Length:197 Identity:46/197 - (23%)
Similarity:68/197 - (34%) Gaps:37/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 TVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQ 152
            ||..|....|.|.|.|:|...::|             :..|| :..|..:.:|..:..:.:..|.
  Rat    43 TVSQGQPVKLNCSVEGMDDPDIHW-------------MKDGA-VVQNASQVSISISEQNWIGLLS 93

  Fly   153 IKFVQRRDHGMYECQVSTPTGI-ISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTP 216
            :|..:|.|.|:|.|||...... ||..|.|.|.....|.:...:|.|.......|.|.....|.|
  Rat    94 LKSAERSDAGLYWCQVKDGEETKISQSVWLTV
EGVPFFTVEPKDLAVPPNVPFQLSCEAVGPPEP 158

  Fly   217 PQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASN------TEPA 275
            ....:|:.                .|..|....|..::....||....::|.|.|      :.||
  Rat   159 VTIFWWRG----------------PTKVGGPASSPSVLNVTGVTQRTEFSCEAHNIKGLATSRPA 207

  Fly   276 SI 277
            .|
  Rat   208 II 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 26/95 (27%)
Ig_3 193..271 CDD:404760 14/77 (18%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 1/4 (25%)
Tyro3NP_058788.1 IG_like 39..125 CDD:214653 26/95 (27%)
IGc2 46..111 CDD:197706 20/78 (26%)
Ig2_Tyro3_like 131..209 CDD:143226 18/93 (19%)
IG_like 135..204 CDD:214653 15/84 (18%)
FN3 215..307 CDD:238020
fn3 315..396 CDD:278470
PTKc_Tyro3 498..781 CDD:270659
Pkinase_Tyr 508..776 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 804..827
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 842..864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.