DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and Igsf9b

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:196 Identity:52/196 - (26%)
Similarity:76/196 - (38%) Gaps:34/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFV 156
            ||:..:.|...|..:..|.|       .::..:|.:.|:...:|         ||    |.:..|
Mouse   156 GGSITMTCTAFGNPKPIVTW-------LKEGTLLGASAKYQVSD---------GS----LTVTSV 200

  Fly   157 QRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYV- 220
            .|.|.|.|.|:..:..|...|..:|.|..|...:.....:.|::.....|.|..|..|....|. 
Mouse   201 SREDRGAYTCRAYSIQGEAVHTTHLLV
QGPPFIVSPPENITVNISQDALLTCRAEAYPGNLTYTW 265

  Fly   221 YWQ-KNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASN----TEPASIYVF 280
            ||| :|....|.:..|..|.|:.|        |||...:..|:|.|||..||    :..||.|:.
Mouse   266 YWQDENVYFQNDLKLRVRILIDGT--------LIIFRVKPEDAGKYTCVPSNSLGRSPSASAYLT 322

  Fly   281 V 281
            |
Mouse   323 V 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 21/90 (23%)
Ig_3 193..271 CDD:404760 23/79 (29%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 2/4 (50%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 3/4 (75%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273
I-set 141..227 CDD:369462 21/90 (23%)
Ig 231..323 CDD:386229 28/99 (28%)
Ig <355..416 CDD:386229
Ig 440..504 CDD:319273
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.