Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011240777.1 | Gene: | Igsf9b / 235086 | MGIID: | 2685354 | Length: | 1443 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 52/196 - (26%) |
---|---|---|---|
Similarity: | 76/196 - (38%) | Gaps: | 34/196 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 GGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFV 156
Fly 157 QRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYV- 220
Fly 221 YWQ-KNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASN----TEPASIYVF 280
Fly 281 V 281 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 21/90 (23%) |
Ig_3 | 193..271 | CDD:404760 | 23/79 (29%) | ||
Ig strand B | 204..208 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 219..223 | CDD:409353 | 2/4 (50%) | ||
Ig strand E | 250..254 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 264..269 | CDD:409353 | 3/4 (75%) | ||
Igsf9b | XP_011240777.1 | Ig | 43..117 | CDD:319273 | |
I-set | 141..227 | CDD:369462 | 21/90 (23%) | ||
Ig | 231..323 | CDD:386229 | 28/99 (28%) | ||
Ig | <355..416 | CDD:386229 | |||
Ig | 440..504 | CDD:319273 | |||
FN3 | 512..607 | CDD:238020 | |||
FN3 | 623..705 | CDD:238020 | |||
PHA03247 | <900..1248 | CDD:223021 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |