| Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001264214.1 | Gene: | IGSF9B / 22997 | HGNCID: | 32326 | Length: | 1437 | Species: | Homo sapiens |
| Alignment Length: | 196 | Identity: | 52/196 - (26%) |
|---|---|---|---|
| Similarity: | 75/196 - (38%) | Gaps: | 34/196 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 92 GGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFV 156
Fly 157 QRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYV- 220
Fly 221 YWQ-KNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASN----TEPASIYVF 280
Fly 281 V 281 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 20/90 (22%) |
| Ig_3 | 193..271 | CDD:404760 | 24/79 (30%) | ||
| Ig strand B | 204..208 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 219..223 | CDD:409353 | 2/4 (50%) | ||
| Ig strand E | 250..254 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 264..269 | CDD:409353 | 3/4 (75%) | ||
| IGSF9B | NP_001264214.1 | IG_like | 30..115 | CDD:214653 | |
| Ig | 41..115 | CDD:143165 | |||
| I-set | 139..225 | CDD:254352 | 20/90 (22%) | ||
| IGc2 | 153..210 | CDD:197706 | 17/75 (23%) | ||
| I-set | 229..321 | CDD:254352 | 29/99 (29%) | ||
| Ig | 235..321 | CDD:299845 | 29/93 (31%) | ||
| IG_like | 331..414 | CDD:214653 | |||
| Ig | <353..414 | CDD:299845 | |||
| IG_like | 426..505 | CDD:214653 | |||
| Ig | 442..505 | CDD:299845 | |||
| FN3 | 510..601 | CDD:238020 | |||
| FN3 | 617..699 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 758..817 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 911..1081 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||