DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and zig-10

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:263 Identity:56/263 - (21%)
Similarity:98/263 - (37%) Gaps:63/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILH---TPGSNMWT 150
            |.:|.|..|.|:       ....:.::|.  ||.|::::     ....:.|||:   ..|.....
 Worm    36 VPIGSTTALECE-------PYTSSNVTWY--RDKHVIAT-----VEGHKNAILNERKPRGGEERI 86

  Fly   151 LQIKF-----VQRRDHGMYECQVSTPT--GII-------------SHFVNLQVVVPEAFILGSGE 195
            .:|.|     ||:.|.|.|.||....:  |.:             :..:.|:..||         
 Worm    87 PEIGFLVIFDVQKEDEGNYYCQRENDSKWGEV
FQLKIAYVDEISQNEKIKLEPNVP--------- 142

  Fly   196 LHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVT 260
               .:|.::.|.|.|.|:..||: |.|..|...|:::.|      :....|  ...|||......
 Worm   143 ---TLGRSLVLHCPIPKAYPPPK-VTWTVNSLPISHISS------DYVAFP--NGTLIISHFSYH 195

  Fly   261 DSGNYTCSASN-TEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRS----MLAPCLLLNTVVV 320
            ..|.:.|:.:| ...||...|:...:.:|.:...|.:..:..:...||    .|..||:.:..|:
 Worm   196 HFGYFECNINNFAGHASTNTFIDSRELVANLESLKPTFVNGCSAALRSSLFMFLLGCLITSGAVL 260

  Fly   321 RHI 323
            .::
 Worm   261 IYL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 24/116 (21%)
Ig_3 193..271 CDD:404760 18/77 (23%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 1/4 (25%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 23/95 (24%)
IGc2 38..111 CDD:197706 21/86 (24%)
IG_like 143..215 CDD:214653 21/80 (26%)
IGc2 145..209 CDD:197706 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.