DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and rig-3

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_509155.1 Gene:rig-3 / 180958 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans


Alignment Length:363 Identity:71/363 - (19%)
Similarity:119/363 - (32%) Gaps:103/363 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLLATTLEPDQKSILTDNDWKKLWMRGGINGDSKLDNNLDSSDSPMF----------EDSELMAH 85
            |:::...|.|::...:|..||:      .||     ||:|...:|..          :..:...|
 Worm    57 LMVSCVFESDEQIHKSDLLWKQ------ANG-----NNIDGESNPSLFSVILNEKGSKHRKTSLH 110

  Fly    86 NTTVQLGGTAFLVC--KVSGVDRV----------GVNWNQISWIRRRDWHILSSGAQL---YTND 135
            .::|....|....|  :.:|.:..          .:.||....::         ||.|   .|.|
 Worm   111 FSSVHTRDTGLYTCTGRTAGGENFEKTIKLVVLPAIEWNDKDTVK---------GALLGEPITID 166

  Fly   136 --------ERFAILHTPGS------NMWTL--------QIKFVQRRDHGMYECQVSTPTGIISH- 177
                    :...|..|.|:      .:||:        .:|    ::|.  |..||..| |..| 
 Worm   167 CGVKGPSGKEPMIQMTNGNGEPLDEEIWTIAGNEATIDSLK----KEHA--ELTVSCIT-IEMHQ 224

  Fly   178 --------FVNLQVVVPEAFILGSGELHVDMGSTI--------NLVCIIEKSPTPPQYVYWQKND 226
                    .|:.:.|..|.:.|...|....:..|:        .:.|.:..|..|.::..:...|
 Worm   225 ETSKEEFPVVDRKDVNIEVYTLPEFETEESVQYTVIDNHVRDAIIYCNVTHSFPPVRHYTFYHGD 289

  Fly   227 RLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAA-- 289
            ..|...|.   ..|....|....:.|.|......|.|.|.|.|:|.:..|.:....:..|..|  
 Worm   290 EEIKMSDK---FNIFVNVGVSQGAHLKIHNVNENDLGTYKCEANNIKAKSYHTIHLREANAPAEP 351

  Fly   290 ----ISRRKTSSADRLTHIFRSMLAPCLLLNTVVVRHI 323
                |..::.|...::..|.|.   |.|.:..|.:||:
 Worm   352 KVTLIEDKRHSIIWKVESIDRD---PDLPMTAVEIRHL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 25/142 (18%)
Ig_3 193..271 CDD:404760 17/85 (20%)
Ig strand B 204..208 CDD:409353 0/11 (0%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
rig-3NP_509155.1 IG_like 48..142 CDD:214653 17/95 (18%)
Ig 267..341 CDD:319273 17/76 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.