DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and Ncam1

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:272 Identity:59/272 - (21%)
Similarity:105/272 - (38%) Gaps:45/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LEPDQKSILTDNDWKKLWMRG---GINGDSKLDNNLDSSDSPMFEDSELMAH------------N 86
            |:.|.:.|:..|::  |.:||   ...|..:.:..:.:.....|:|.:::.:            |
Mouse   160 LKKDVRFIVLSNNY--LQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVN 222

  Fly    87 TTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTL 151
            .|..||.:..|||...|.....::|              :...:...|:|.....|....:...|
Mouse   223 ATANLGQSVTLVCDADGFPEPTMSW--------------TKDGEPIENEEEDDEKHIFSDDSSEL 273

  Fly   152 QIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTP 216
            .|:.|.:.|...|.|......|.....::|:|...........:..:::...:.|.|  |.|..|
Mouse   274 TIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPKITYVENQTAMELEEQVTLTC--EASGDP 336

  Fly   217 PQYVYWQKNDRLINYVDS---RRDITIETTPG---PRTQSR---LIIREPQVTDSGNYTCSASNT 272
            ...:.|:.:.|.|:..:.   .|....||..|   .|:.:|   |.::..|.||:|.|.|:||||
Mouse   337 IPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNT 401

  Fly   273 ---EPASIYVFV 281
               :..|:|:.|
Mouse   402 IGQDSQSMYLEV 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 20/96 (21%)
Ig_3 193..271 CDD:404760 22/86 (26%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 2/6 (33%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 8/31 (26%)
Ig3_NCAM-1_like 211..308 CDD:143207 21/110 (19%)
Ig_NCAM-1 307..413 CDD:143277 27/107 (25%)
Ig_3 417..494 CDD:372822
FN3 509..606 CDD:238020
fn3 649..731 CDD:365830
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.