DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and zig-8

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:208 Identity:52/208 - (25%)
Similarity:97/208 - (46%) Gaps:34/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 AFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRR 159
            |:|.|.|.....     ::|:|.|..|..:|::|.:.:|.|.|:.: ....:|:|.|.::..:::
 Worm    53 AYLHCSVPPDAE-----HEIAWTRVSDGALLTAGNRTFTRDPRWQV-SKKSANIWVLNLRRAEQQ 111

  Fly   160 DHGMYECQVSTPTGIISHFVNLQVV-----VPEAFILGSGELHVDM-GSTINLVCIIEKSPTPPQ 218
            |.|.|.|:::.....: :.|.|:|:     .|.:....|.:|..:| |..:.|.|.:..:....:
 Worm   112 DSGCYLCEINDKHNTV-YAVYLKVLEPPLPSPSSLQKKSTKLMANMSGDEVVLNCTVTSTDKDEE 175

  Fly   219 Y--VYWQKNDRLINYVDS-------RRD--ITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNT 272
            .  |.|.::...||:.|:       :||  :.|||         :.||:..:.|.|||.|..|. 
 Worm   176 VLDVVWTRDGNTINFNDTEKYILKVKRDAGVVIET---------MRIRKATMEDDGNYACEHSQ- 230

  Fly   273 EPASIYVFVSKGD 285
            :.||..|.::|.:
 Worm   231 QKASQIVHINKAE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 22/87 (25%)
Ig_3 193..271 CDD:404760 23/89 (26%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/5 (20%)
Ig strand E 250..254 CDD:409353 0/3 (0%)
Ig strand F 264..269 CDD:409353 3/4 (75%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 21/85 (25%)
Ig 55..129 CDD:143165 19/80 (24%)
ig 158..229 CDD:278476 20/79 (25%)
IG_like 158..227 CDD:214653 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I7153
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.