DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and rig-5

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:159 Identity:43/159 - (27%)
Similarity:57/159 - (35%) Gaps:42/159 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 YTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGEL 196
            |....|...||    |.|.|.||.||..|.|.|.||::|                |...|.:|||
 Worm   141 YELKPRIGDLH----NEWVLTIKNVQESDRGNYSCQINT----------------EPITLSTGEL 185

  Fly   197 HVDM----------------GSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPG 245
            .|.:                |:.::|.|..:.:|||.  |.|::.||.|...:...........|
 Worm   186 DVKVPPVVSRSTPAAVEVREGNNVSLTCKADGNPTPT--VIWRRQDRQIIRYNGATGFGASVFHG 248

  Fly   246 PRTQSRLIIREPQVTDSGNYTCSASNTEP 274
            |......:.|:    ....|.|.|||..|
 Worm   249 PVLHLTKVSRK----HMSEYLCVASNGIP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 17/50 (34%)
Ig_3 193..271 CDD:404760 21/93 (23%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 0/3 (0%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 23/67 (34%)
Ig_3 191..270 CDD:372822 17/84 (20%)
IG 294..380 CDD:214652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.