Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006522949.1 | Gene: | Dscam / 13508 | MGIID: | 1196281 | Length: | 2034 | Species: | Mus musculus |
Alignment Length: | 221 | Identity: | 58/221 - (26%) |
---|---|---|---|
Similarity: | 86/221 - (38%) | Gaps: | 42/221 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 91 LGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKF 155
Fly 156 VQRRDHGMYECQVSTPTGIISHFVNLQVVVPEA---FILGSGELHVDMGSTINLVCIIEKSPTPP 217
Fly 218 QYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTE--------- 273
Fly 274 ----PASIYVFVSKGDNMAAISRRKT 295 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 20/91 (22%) |
Ig_3 | 193..271 | CDD:404760 | 24/77 (31%) | ||
Ig strand B | 204..208 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 219..223 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 250..254 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 264..269 | CDD:409353 | 2/4 (50%) | ||
Dscam | XP_006522949.1 | Ig | 15..115 | CDD:386229 | |
IGc2 | 239..300 | CDD:197706 | |||
IG | 320..400 | CDD:214652 | 20/91 (22%) | ||
Ig_3 | 410..488 | CDD:372822 | 25/80 (31%) | ||
IGc2 | 518..575 | CDD:197706 | 2/4 (50%) | ||
Ig | 596..686 | CDD:386229 | |||
Ig_DSCAM | 707..784 | CDD:143211 | |||
Ig | 802..889 | CDD:386229 | |||
FN3 | 885..978 | CDD:238020 | |||
FN3 | 986..1083 | CDD:238020 | |||
FN3 | 1091..1184 | CDD:238020 | |||
FN3 | 1189..1278 | CDD:238020 | |||
Ig_3 | 1301..1363 | CDD:372822 | |||
FN3 | 1380..1470 | CDD:238020 | |||
FN3 | 1486..1555 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |