| Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001074739.2 | Gene: | Dscaml1 / 114873 | MGIID: | 2150309 | Length: | 2053 | Species: | Mus musculus |
| Alignment Length: | 241 | Identity: | 56/241 - (23%) |
|---|---|---|---|
| Similarity: | 85/241 - (35%) | Gaps: | 55/241 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 91 LGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPG--------SN 147
Fly 148 MWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPE----AFILGSGELHVDMGSTINLVC 208
Fly 209 IIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTE 273
Fly 274 PASIYVFVSKGDNMAAISRRKTSSADRLTHIF----RSMLAPCLLL 315 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 22/99 (22%) |
| Ig_3 | 193..271 | CDD:404760 | 22/77 (29%) | ||
| Ig strand B | 204..208 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 219..223 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 250..254 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 264..269 | CDD:409353 | 2/4 (50%) | ||
| Dscaml1 | NP_001074739.2 | IGc2 | 43..110 | CDD:197706 | |
| Ig | 125..218 | CDD:353325 | |||
| I-set | 226..311 | CDD:336764 | |||
| Ig_3 | 317..389 | CDD:339005 | 21/85 (25%) | ||
| Ig | 408..498 | CDD:353325 | 24/100 (24%) | ||
| IGc2 | 519..577 | CDD:197706 | 3/11 (27%) | ||
| Ig | 615..681 | CDD:319273 | |||
| Ig_DSCAM | 707..785 | CDD:143211 | |||
| Ig | 803..891 | CDD:353325 | |||
| FN3 | 887..981 | CDD:238020 | |||
| FN3 | 988..1085 | CDD:238020 | |||
| FN3 | 1093..1186 | CDD:238020 | |||
| FN3 | 1191..1282 | CDD:238020 | |||
| Ig | 1307..1377 | CDD:319273 | |||
| FN3 | 1384..1474 | CDD:238020 | |||
| FN3 | 1488..1560 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1716..1741 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1773..1803 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1840..1862 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1974..2053 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||