DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and ntm

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:315 Identity:69/315 - (21%)
Similarity:105/315 - (33%) Gaps:123/315 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 NTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWT 150
            |.||:.|.:|.|.|.|.  :||    .:::|:.|..  ||.:|...::.|.|..:|....| .::
 Frog    45 NVTVRQGDSAILRCTVD--NRV----TRVAWLNRST--ILYTGNDKWSIDPRVVLLANTKS-QYS 100

  Fly   151 LQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPT 215
            ::|:.|...|.|.|.|.|.|.....:..|:|.|.||...:..|..:.|:.||.::|:||....|.
 Frog   101 IEIQNVDIYDEGPYTCSVQTDNHPKTSRVHLIVQVPPRIVDISSSIAVNEGSNVSLICIANGRPE 165

  Fly   216 P--------------------------------------------------------PQYV---- 220
            |                                                        |.|:    
 Frog   166 PVVNWRYLSPKARGFVSEDEYLEITGITREQSGIYECSASNDVSAPDVRRVKLTVNYPPYILDAQ 230

  Fly   221 ------------------------YWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTD 261
                                    :|.|.|:.::  ||.|.:.:|..   .|.||:........|
 Frog   231 NIGAPLGHRGILQCEASAVPAADFFWYKEDKRLS--DSWRGVKVENR---ETISRVTFLNVSEQD 290

  Fly   262 SGNYTCSASNT---EPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCL 313
            .|||||.|.|.   ..|||.:|                      .:|:|..:|.|
 Frog   291 YGNYTCMAKNLLGHSNASIILF----------------------ELFQSTSSPLL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 29/96 (30%)
Ig_3 193..271 CDD:404760 28/161 (17%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/31 (3%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 4/4 (100%)
ntmXP_004916061.1 Ig 45..133 CDD:299845 29/96 (30%)
IG_like 45..133 CDD:214653 29/96 (30%)
IG_like 143..220 CDD:214653 9/76 (12%)
IGc2 150..209 CDD:197706 7/58 (12%)
ig 227..311 CDD:278476 21/88 (24%)
IG_like 230..311 CDD:214653 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.