DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and iglon5

DIOPT Version :10

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:189 Identity:51/189 - (26%)
Similarity:81/189 - (42%) Gaps:29/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 AHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNM 148
            |.|.||..|..|.|.|.:.  |:|    .:::|:.|.  :||.:|...::.|.|..:| |...:.
 Frog    33 ADNYTVSQGDNATLSCLID--DKV----TRVAWLNRS--NILYAGKDKWSIDSRVQLL-TNTKSE 88

  Fly   149 WTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKS 213
            :::.|..|...|.|:|.|...|.....:..|.|.|.||...:..|..:.|:.||.:||.|:....
 Frog    89 YSIVITHVDVADEGLYTCSFQTEDKPHTSQVYLIVQVPAKIVNISSSVTVNEGSNVNLQCLAVGK 153

  Fly   214 PTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLI-IREPQVTDSGNYTCSASN 271
            |.|.  :.||                 :.:.|..::..|: |.|.....:|:|.|..||
 Frog   154 PEPT--ITWQ-----------------QLSEGFSSEGELLEITEINRQQAGDYECVTSN 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG_like 86..183 CDD:214653 27/96 (28%)
Ig strand B 95..99 CDD:409353 2/3 (67%)
Ig strand C 109..117 CDD:409353 0/7 (0%)
Ig strand E 149..153 CDD:409353 0/3 (0%)
Ig strand F 163..168 CDD:409353 2/4 (50%)
Ig strand G 176..179 CDD:409353 0/2 (0%)
Ig_3 195..271 CDD:464046 17/76 (22%)
iglon5XP_002938252.1 Ig 31..123 CDD:472250 28/98 (29%)
Ig strand B 44..48 CDD:409353 2/3 (67%)
Ig strand C 56..60 CDD:409353 0/3 (0%)
Ig strand E 89..93 CDD:409353 0/3 (0%)
Ig strand F 103..108 CDD:409353 2/4 (50%)
Ig strand G 116..119 CDD:409353 0/2 (0%)
Ig 122..207 CDD:472250 23/91 (25%)
Ig strand B 144..148 CDD:409353 2/3 (67%)
Ig strand C 157..160 CDD:409353 0/4 (0%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
Ig strand G 200..203 CDD:409353
Ig_3 210..288 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.