| Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031755650.1 | Gene: | negr1 / 100127726 | XenbaseID: | XB-GENE-987949 | Length: | 388 | Species: | Xenopus tropicalis |
| Alignment Length: | 274 | Identity: | 63/274 - (22%) |
|---|---|---|---|
| Similarity: | 100/274 - (36%) | Gaps: | 92/274 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 86 NTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWT 150
Fly 151 LQIKFVQRRDHGMYECQVSTPTGIISHFVNLQV-VVPEAFILGSGELHVDMGSTINLVCIIEKSP 214
Fly 215 TPP----------------QY--VYWQKNDRLINY-VDSRRDIT-----------------IETT 243
Fly 244 P-------------------------------------GPRTQ---SRLIIREPQVTDS--GNYT 266
Fly 267 CSASN---TEPASI 277 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr12 | NP_652462.3 | IG_like | 86..183 | CDD:214653 | 27/96 (28%) |
| Ig strand B | 95..99 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 109..117 | CDD:409353 | 0/7 (0%) | ||
| Ig strand E | 149..153 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 163..168 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 176..179 | CDD:409353 | 0/2 (0%) | ||
| Ig_3 | 195..271 | CDD:464046 | 28/153 (18%) | ||
| negr1 | XP_031755650.1 | Ig | 44..136 | CDD:472250 | 27/96 (28%) |
| Ig strand B | 57..61 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 70..73 | CDD:409353 | 1/8 (13%) | ||
| Ig strand E | 102..106 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 116..121 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 129..132 | CDD:409353 | 0/2 (0%) | ||
| Ig | 146..222 | CDD:472250 | 13/75 (17%) | ||
| Ig strand B | 157..161 | CDD:409301 | 1/3 (33%) | ||
| Ig strand C | 170..174 | CDD:409301 | 0/3 (0%) | ||
| Ig strand E | 187..191 | CDD:409301 | 2/3 (67%) | ||
| Ig strand F | 201..206 | CDD:409301 | 1/4 (25%) | ||
| Ig strand G | 215..218 | CDD:409301 | 0/2 (0%) | ||
| Ig_3 | 226..302 | CDD:464046 | 16/75 (21%) |