| Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031755650.1 | Gene: | negr1 / 100127726 | XenbaseID: | XB-GENE-987949 | Length: | 388 | Species: | Xenopus tropicalis |
| Alignment Length: | 274 | Identity: | 63/274 - (22%) |
|---|---|---|---|
| Similarity: | 100/274 - (36%) | Gaps: | 92/274 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 86 NTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWT 150
Fly 151 LQIKFVQRRDHGMYECQVSTPTGIISHFVNLQV-VVPEAFILGSGELHVDMGSTINLVCIIEKSP 214
Fly 215 TPP----------------QY--VYWQKNDRLINY-VDSRRDIT-----------------IETT 243
Fly 244 P-------------------------------------GPRTQ---SRLIIREPQVTDS--GNYT 266
Fly 267 CSASN---TEPASI 277 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 27/96 (28%) |
| Ig_3 | 193..271 | CDD:404760 | 29/155 (19%) | ||
| Ig strand B | 204..208 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 219..223 | CDD:409353 | 2/5 (40%) | ||
| Ig strand E | 250..254 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 264..269 | CDD:409353 | 4/4 (100%) | ||
| negr1 | XP_031755650.1 | Ig | 44..136 | CDD:416386 | 27/96 (28%) |
| FR1 | 44..62 | CDD:409353 | 6/13 (46%) | ||
| Ig strand A' | 47..53 | CDD:409353 | 2/4 (50%) | ||
| Ig strand B | 55..63 | CDD:409353 | 4/7 (57%) | ||
| CDR1 | 63..68 | CDD:409353 | 0/4 (0%) | ||
| FR2 | 69..75 | CDD:409353 | 2/11 (18%) | ||
| Ig strand C | 69..74 | CDD:409353 | 2/10 (20%) | ||
| CDR2 | 76..87 | CDD:409353 | 2/12 (17%) | ||
| Ig strand C' | 78..82 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 84..87 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 88..122 | CDD:409353 | 11/34 (32%) | ||
| Ig strand D | 91..98 | CDD:409353 | 3/7 (43%) | ||
| Ig strand E | 101..107 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 114..122 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 123..127 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 127..136 | CDD:409353 | 2/8 (25%) | ||
| FR4 | 129..136 | CDD:409353 | 2/6 (33%) | ||
| Ig_3 | 140..208 | CDD:404760 | 13/68 (19%) | ||
| Ig strand A' | 146..151 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 157..164 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 170..175 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 177..179 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 187..193 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 200..207 | CDD:409353 | 1/6 (17%) | ||
| Ig strand G | 214..222 | CDD:409353 | 0/7 (0%) | ||
| Ig_3 | 226..302 | CDD:404760 | 16/75 (21%) | ||
| putative Ig strand A | 226..232 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 242..246 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 255..259 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 281..285 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 295..300 | CDD:409353 | 4/4 (100%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||