DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32354 and Spink8

DIOPT Version :10

Sequence 1:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_898959.2 Gene:Spink8 / 78709 MGIID:1925959 Length:105 Species:Mus musculus


Alignment Length:39 Identity:14/39 - (35%)
Similarity:19/39 - (48%) Gaps:2/39 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 KRNDKLCGTDAKTYNNECELAHATCL--RGVNLAHIGPC 493
            |.::.:||::..||..||.|......  |.|...|.|||
Mouse    58 KVSEPICGSNQVTYEGECHLCSGILYEDRTVIKVHDGPC 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:412159
KAZAL 220..266 CDD:197624
KAZAL_FS 326..>359 CDD:412159
KAZAL 380..430 CDD:197624
KAZAL 452..493 CDD:197624 12/37 (32%)
KAZAL 502..>536 CDD:197624
KAZAL_FS 553..597 CDD:412159
KAZAL 606..650 CDD:197624
Spink8NP_898959.2 KAZAL_FS 49..96 CDD:412159 12/37 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.