DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32354 and SPINK1

DIOPT Version :10

Sequence 1:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_003113.2 Gene:SPINK1 / 6690 HGNCID:11244 Length:79 Species:Homo sapiens


Alignment Length:49 Identity:18/49 - (36%)
Similarity:28/49 - (57%) Gaps:4/49 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 QLKGCARICPREFEPVCGSDNKTYLNDCFLEIENCRANQTVNVNYYGAC 650
            :|.||.:|    ::||||:|..||.|:|.|..||.:...::.:...|.|
Human    35 ELNGCTKI----YDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:412159
KAZAL 220..266 CDD:197624
KAZAL_FS 326..>359 CDD:412159
KAZAL 380..430 CDD:197624
KAZAL 452..493 CDD:197624
KAZAL 502..>536 CDD:197624
KAZAL_FS 553..597 CDD:412159
KAZAL 606..650 CDD:197624 15/43 (35%)
SPINK1NP_003113.2 KAZAL_PSTI 35..79 CDD:238648 17/47 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.