powered by:
Protein Alignment CG32354 and SPINK1
DIOPT Version :9
Sequence 1: | NP_729380.1 |
Gene: | CG32354 / 50302 |
FlyBaseID: | FBgn0052354 |
Length: | 662 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001341895.1 |
Gene: | SPINK1 / 6690 |
HGNCID: | 11244 |
Length: | 79 |
Species: | Homo sapiens |
Alignment Length: | 49 |
Identity: | 18/49 - (36%) |
Similarity: | 28/49 - (57%) |
Gaps: | 4/49 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 602 QLKGCARICPREFEPVCGSDNKTYLNDCFLEIENCRANQTVNVNYYGAC 650
:|.||.:| ::||||:|..||.|:|.|..||.:...::.:...|.|
Human 35 ELNGCTKI----YDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
44 |
1.000 |
Domainoid score |
I12300 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3649 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.