DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32354 and FSTL5

DIOPT Version :9

Sequence 1:	NP_729380.1	Gene:	CG32354 / 50302	FlyBaseID:	FBgn0052354	Length:	662	Species:	Drosophila melanogaster
Sequence 2:	NP_064501.2	Gene:	FSTL5 / 56884	HGNCID:	21386	Length:	847	Species:	Homo sapiens

Alignment Length:	105	Identity:	28/105 - (26%)
Similarity:	45/105 - (42%)	Gaps:	27/105 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   285 KDGPVCSSDGNVYNSTCEMKLKTCGQGVVKTSRKHCQSTR-------MCRESCWRVARPTCGSDG 342
            :|||.         .:||.|.  ||.|      :||.::|       .|.:.|.|..:|.|||||
Human    58 QDGPF---------GSCENKY--CGLG------RHCVTSRETGQAECACMDLCKRHYKPVCGSDG 105

  Fly   343 RLYASPCKMRSSNCGKHVFEVPLSYCMSQERHGASDACPT 382
            ..|.:.|::..:.|.|   :..::...:::.....|.|.|
Human   106 EFYENHCEVHRAACLK---KQKITIVHNEDCFFKGDKCKT 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32354	NP_729380.1	KAZAL_FS	163..>200	CDD:294071
		KAZAL	220..266	CDD:197624
		KAZAL_FS	326..>359	CDD:294071	12/32 (38%)
		KAZAL	380..430	CDD:197624	2/3 (67%)
		KAZAL	452..493	CDD:197624
		KAZAL	502..>536	CDD:197624
		KAZAL_FS	553..597	CDD:294071
		KAZAL	606..650	CDD:197624
FSTL5	NP_064501.2	KAZAL_FS	93..133	CDD:238052	12/42 (29%)
		EFh	180..243	CDD:298682
		EF-hand_7	182..242	CDD:290234
		IG_like	260..339	CDD:214653
		IGc2	263..325	CDD:197706
		I-set	341..430	CDD:254352
		Ig2_Follistatin_like	358..433	CDD:143213
		YncE	<506..734	CDD:225926
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910