DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32354 and fstl5

DIOPT Version :9

Sequence 1:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001027012.2 Gene:fstl5 / 566192 ZFINID:ZDB-GENE-070127-1 Length:854 Species:Danio rerio


Alignment Length:209 Identity:48/209 - (22%)
Similarity:76/209 - (36%) Gaps:54/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ALLAMFTLAAFASTTSGAVTDSPIKIIRLPAQAPVIRYRSADAAPNSLLINYRQDARPELSSTLM 124
            |::.::..|..|....|....:|      ||..|::|:|..|....||          .:...|.
Zfish    16 AVVLLWAAALMAEARPGKEGFTP------PAYRPLVRFRHKDGISESL----------RMKGFLG 64

  Fly   125 QA--PGAAAAALESLLREETEQQQLSQMGRR---NRASNTGTGNCPRSCPPSITVGAEPVCGSDG 184
            |.  ||..             :.:...:|:.   :|.:..|...|...|.|..    :|||||||
Zfish    65 QTGFPGPC-------------EHKYCGLGKHCVVDRETGEGECQCLERCKPHY----KPVCGSDG 112

  Fly   185 LIYANICELRKKTC-SRSGVSLIKDVRDGCERSKGSDCKHRCSTEKDPVCGTDGRTYLNRCMLRV 248
            .:|.|.|||.:.:| :...::::          ...:|.:     ||..|.......|...||.:
Zfish   113 KLYQNHCELHRASCLAHQRITIM----------HSDECFY-----KDDNCRLGDYKKLKSKMLDI 162

  Fly   249 QSCRVGLAAVKLSH 262
            .:.|...||...||
Zfish   163 HAQRYLTAANHGSH 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:294071 16/37 (43%)
KAZAL 220..266 CDD:197624 12/43 (28%)
KAZAL_FS 326..>359 CDD:294071
KAZAL 380..430 CDD:197624
KAZAL 452..493 CDD:197624
KAZAL 502..>536 CDD:197624
KAZAL_FS 553..597 CDD:294071
KAZAL 606..650 CDD:197624
fstl5NP_001027012.2 KAZAL 95..140 CDD:197624 16/58 (28%)
EFh 187..245 CDD:238008
EF-hand_7 189..249 CDD:290234
IG_like 263..344 CDD:214653
IGc2 270..332 CDD:197706
I-set 348..437 CDD:254352
Ig2_Follistatin_like 365..440 CDD:143213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.