DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32354 and Spink14

DIOPT Version :10

Sequence 1:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001034307.2 Gene:Spink14 / 433178 MGIID:3646952 Length:96 Species:Mus musculus


Alignment Length:91 Identity:24/91 - (26%)
Similarity:38/91 - (41%) Gaps:15/91 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   560 AQPPSFVCGSDNNLYKSECHMRKENCGKHVFVVPLKRCLAAFQLKGCARICPREFEPVCGSDNKT 624
            |.|.:.|....:.|.|.:|..:|.|             |:.|  ......||...:|:||::..|
Mouse    21 AAPGARVWWPTHGLIKIKCPYKKVN-------------LSWF--NKTVDPCPDLKQPICGTNFVT 70

  Fly   625 YLNDCFLEIENCRANQTVNVNYYGAC 650
            |.|.|.|.:|:.::...:...|.|.|
Mouse    71 YDNPCILCVESLKSGGRIRYYYNGRC 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:412159
KAZAL 220..266 CDD:197624
KAZAL_FS 326..>359 CDD:412159
KAZAL 380..430 CDD:197624
KAZAL 452..493 CDD:197624
KAZAL 502..>536 CDD:197624
KAZAL_FS 553..597 CDD:412159 8/36 (22%)
KAZAL 606..650 CDD:197624 13/43 (30%)
Spink14NP_001034307.2 KAZAL_FS 55..96 CDD:412159 13/40 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.