DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32354 and Spink14

DIOPT Version :9

Sequence 1:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001008875.1 Gene:Spink14 / 408231 RGDID:1303288 Length:98 Species:Rattus norvegicus


Alignment Length:42 Identity:17/42 - (40%)
Similarity:24/42 - (57%) Gaps:1/42 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 CSTEKDPVCGTDGRTYLNRCMLRVQSCRVGLAAVKLSHVGPC 266
            |...|.|:|||:..||.|.|:|.|:|.:.| ..::..|.|.|
  Rat    58 CPGLKQPICGTNFVTYDNPCILCVESLKSG-GQIRYYHTGRC 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:294071
KAZAL 220..266 CDD:197624 16/40 (40%)
KAZAL_FS 326..>359 CDD:294071
KAZAL 380..430 CDD:197624
KAZAL 452..493 CDD:197624
KAZAL 502..>536 CDD:197624
KAZAL_FS 553..597 CDD:294071
KAZAL 606..650 CDD:197624
Spink14NP_001008875.1 KAZAL_PSTI 57..98 CDD:238648 16/40 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.