DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32354 and ZK813.6

DIOPT Version :9

Sequence 1:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001033579.1 Gene:ZK813.6 / 3896892 WormBaseID:WBGene00044564 Length:251 Species:Caenorhabditis elegans


Alignment Length:248 Identity:65/248 - (26%)
Similarity:98/248 - (39%) Gaps:45/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 RSKGSDCKHRCSTEKDPVCGTDG---RTYLNRCMLRVQSCRVGLAAVKLSHVGPCSNTSAVRESC 276
            |...|.|.  |..|.||||..:|   .||.|:|:.  |..:.....:.|.:.|.|.:...     
 Worm    19 REPNSTCS--CKPEIDPVCVREGPYQYTYSNKCVF--QCAQENKKDLVLLYEGSCCSARY----- 74

  Fly   277 PVDCNSAPKDGPVCSSDGNVYNSTCEMKLKTC-------GQGVVKTSRKHCQSTRMCRESCWRVA 334
               ||..  :.||| |:|.:|.:.||.:.:.|       ....:.:|::.|..|..|... |   
 Worm    75 ---CNMF--EQPVC-SEGQMYQTVCEFEERQCIEFKLFKNHISMDSSQEKCSCTAPCPTE-W--- 129

  Fly   335 RPTCGSDGRLYASPCKMRSSNCGKHVFEVPLSYCMSQERHGASDACPTECPKSDTDSSSQYVCGS 399
            .|.|...|:.:|:.|...:|.|   ..:..|:..:..:..|.  .|...|....|   |..||.|
 Worm   130 NPVCDKKGQTHANFCTFLNSKC---YHKNQLNESLEVDYSGV--CCEDMCSAGQT---SLTVCDS 186

  Fly   400 DGNIYSSLCELKMLNCGPQRKSIQKVSMDKCKNRLTRCKQLPPCKDFNSLFGS 452
            :||.::.:|...:..|...|:.|.       |.|| :...:.|||..|..|.|
 Worm   187 EGNTHTDICSFYIAKCRQMRRGIG-------KKRL-QIAGVGPCKPKNPFFRS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:294071
KAZAL 220..266 CDD:197624 15/48 (31%)
KAZAL_FS 326..>359 CDD:294071 9/32 (28%)
KAZAL 380..430 CDD:197624 13/49 (27%)
KAZAL 452..493 CDD:197624 1/1 (100%)
KAZAL 502..>536 CDD:197624
KAZAL_FS 553..597 CDD:294071
KAZAL 606..650 CDD:197624
ZK813.6NP_001033579.1 KAZAL 121..169 CDD:197624 12/56 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283825at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.