DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32354 and Fstl4

DIOPT Version :9

Sequence 1:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_796033.2 Gene:Fstl4 / 320027 MGIID:2443199 Length:841 Species:Mus musculus


Alignment Length:303 Identity:70/303 - (23%)
Similarity:99/303 - (32%) Gaps:98/303 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 RESCPVDCNSAPKDGPVCSSDGNVYNSTCEMKLKTCGQGVVKTSRKHCQSTRMCRESCWRVARPT 337
            ||..|....||.....:||     :.|.|.:. :|.||       ..||    |.|.|.....|.
Mouse    52 REGLPSPGLSASCGKKLCS-----HGSRCLLN-RTTGQ-------PSCQ----CLEVCRPRYMPV 99

  Fly   338 CGSDGRLYASPCKMRSSNC--GKHVFEVPLSYCMSQERHGASDAC-------------------- 380
            ||||||||.:.|::|.:.|  ||.:..|....|..:     .|.|                    
Mouse   100 CGSDGRLYGNHCELRRAACLLGKRIVSVHSKDCFLK-----GDMCTMAGYARLKNVLLALQSRRQ 159

  Fly   381 --PTECPKSDTDSSSQYVCGS-------DGNIYSSLCELKMLNCGPQRKSIQKVSMDKCKNRLTR 436
              |...|:....|..:.:..|       |||.:....||       .:..:::..||   ..|.|
Mouse   160 PLPQGTPRQSLASQKRLLVESLFKDLDADGNGHLGSLEL-------AQYVLKEQDMD---GSLNR 214

  Fly   437 C--KQLPPCKDFNS----LFGSIFSSKR--------NDKLCGTDAKTYNNECELAHATCLRGVNL 487
            |  ..|....|:||    ..|..:::.:        .||:..|...                |.|
Mouse   215 CSPSDLLRFDDYNSDGSLTLGEFYTAFQVIQLSLAPEDKVSVTTVT----------------VGL 263

  Fly   488 AHIGPCT---DLNSPT--KDCGDACTRADLEQQPVCGSDGNTF 525
            :.:..|.   ||..|.  |..|...:...||.....|.||:.:
Mouse   264 STVLTCAIRGDLRPPIIWKRNGLTLSFLGLEDINDFGEDGSLY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:294071
KAZAL 220..266 CDD:197624
KAZAL_FS 326..>359 CDD:294071 16/34 (47%)
KAZAL 380..430 CDD:197624 12/78 (15%)
KAZAL 452..493 CDD:197624 5/48 (10%)
KAZAL 502..>536 CDD:197624 6/24 (25%)
KAZAL_FS 553..597 CDD:294071
KAZAL 606..650 CDD:197624
Fstl4NP_796033.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..54 1/1 (100%)
KAZAL_FS 92..132 CDD:238052 16/39 (41%)
EFh 178..242 CDD:298682 16/73 (22%)
EF-hand_7 178..241 CDD:290234 16/72 (22%)
IG_like 255..322 CDD:214653 14/68 (21%)
Ig 266..322 CDD:143165 11/41 (27%)
I-set 340..429 CDD:254352
Ig2_Follistatin_like 357..432 CDD:143213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.