DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32354 and Fstl5

DIOPT Version :9

Sequence 1:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001240648.1 Gene:Fstl5 / 213262 MGIID:2442179 Length:847 Species:Mus musculus


Alignment Length:317 Identity:66/317 - (20%)
Similarity:99/317 - (31%) Gaps:100/317 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 DGPVCSSDGNVYNSTCEMKLKTCGQG---VVKTSRKHCQSTRMCRESCWRVARPTCGSDGRLYAS 347
            |||.         .:||.|.  ||.|   |:....:|.:..  |.:.|.:..:|.|||||..|.:
Mouse    59 DGPF---------GSCENKY--CGLGRHCVINRETRHAECA--CMDLCKQHYKPVCGSDGEFYEN 110

  Fly   348 PCKMRSSNCGKHVFEVPLSYCMSQERHGASDAC-----------------------PTECPKSD- 388
            .|::..:.|.|   :..::...:::.....|.|                       ..|.|.|| 
Mouse   111 HCEVHRAACLK---KQKITIVHNEDCFFEGDNCMAIEYSKMKSMLLDLQNQKYITQENENPNSDD 172

  Fly   389 -------TDSSSQYVCGSDGNIYSSLCELKMLNCGPQRKSIQKVSMDKCKNRLTRCK--QLPPCK 444
                   .|...:|. .:|.|....:.||           .|.:..::....|:.|.  .|....
Mouse   173 ISRKKPLVDQMFKYF-DADSNGLVDINEL-----------TQVIKQEELNKDLSDCTLYDLLKYD 225

  Fly   445 DFNS-----------LFGSIFSSKRNDKLCGTDAKTYNNECELAHATCLRGVNLAHIGPCTDLNS 498
            |||:           .|..|..|...|:.....|.|......|   :|      |.:|   .|..
Mouse   226 DFNADKHLALEEFYRAFQVIQLSLPEDQRVSITAATVGQSAVL---SC------AIVG---TLRP 278

  Fly   499 PT--KDCGDACTRADLEQQPVCGSDGNTFASMCEFKRRTCDLRVVPVSLKNCALTAD 553
            |.  |.........|||.....|.||:.:.:           :|..|.:.|....||
Mouse   279 PIIWKRNNIVLNNLDLEDINDFGDDGSLYIT-----------KVTTVHMGNYTCYAD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:294071
KAZAL 220..266 CDD:197624
KAZAL_FS 326..>359 CDD:294071 11/32 (34%)
KAZAL 380..430 CDD:197624 12/80 (15%)
KAZAL 452..493 CDD:197624 9/40 (23%)
KAZAL 502..>536 CDD:197624 6/33 (18%)
KAZAL_FS 553..597 CDD:294071 1/1 (100%)
KAZAL 606..650 CDD:197624
Fstl5NP_001240648.1 KAZAL_FS 93..133 CDD:238052 11/42 (26%)
EF-hand_7 182..243 CDD:372618 12/72 (17%)
Ig 266..323 CDD:319273 16/79 (20%)
Ig2_Follistatin_like 358..433 CDD:143213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.