DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32354 and Fstl1

DIOPT Version :9

Sequence 1:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_032073.2 Gene:Fstl1 / 14314 MGIID:102793 Length:306 Species:Mus musculus


Alignment Length:246 Identity:54/246 - (21%)
Similarity:86/246 - (34%) Gaps:66/246 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 CKHRCSTEKDPVCGTDGRTYLNRCMLRVQSCRVGLAAVKLSHVGPC-SNTSAVRESCPVDCNSAP 284
            |..:|...|.||||::|:||||.|.|...:|..| :.:::.:.|.| ...||...:.||.|..|.
Mouse    52 CIEQCKPHKRPVCGSNGKTYLNHCELHRDACLTG-SKIQVDYDGHCKEKKSASPSASPVVCYQAN 115

  Fly   285 K-----------------DGPVCSSDGNVYNSTCEMKLKTCGQGVVKTSRKHCQSTRMCR----- 327
            :                 ||  ..|.|:.|:...:...|:...|     ..|..|:...:     
Mouse   116 RDELRRRLIQWLEAEIIPDG--WFSKGSNYSEILDKYFKSFDNG-----DSHLDSSEFLKFVEQN 173

  Fly   328 ESCWRVARPTCGSDGRLYASPC-----KMRSSN------------CGKHVFEVPLSYCMSQERHG 375
            |:...:.......:.:|..|.|     ::...|            |....|..|...|..::...
Mouse   174 ETAINITTYADQENNKLLRSLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETY 238

  Fly   376 ASDACPTE--CPKSDTDSSSQYVCGSDGNIYSSLCELKMLNC-GPQRKSIQ 423
            | |...||  |.:. ..|...:||.:             :.| |..:|.:|
Mouse   239 A-DGAETEVDCNRC-VCSCGHWVCTA-------------MTCDGKNQKGVQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:294071
KAZAL 220..266 CDD:197624 17/44 (39%)
KAZAL_FS 326..>359 CDD:294071 6/54 (11%)
KAZAL 380..430 CDD:197624 10/47 (21%)
KAZAL 452..493 CDD:197624
KAZAL 502..>536 CDD:197624
KAZAL_FS 553..597 CDD:294071
KAZAL 606..650 CDD:197624
Fstl1NP_032073.2 FOLN 29..51 CDD:128570
KAZAL 52..96 CDD:197624 17/44 (39%)
EF-hand_7 147..218 CDD:290234 9/75 (12%)
EFh 147..218 CDD:298682 9/75 (12%)
VWC 231..>278 CDD:302663 13/59 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.