DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32354 and LOC1278373

DIOPT Version :10

Sequence 1:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_317819.5 Gene:LOC1278373 / 1278373 VectorBaseID:AGAMI1_000066 Length:82 Species:Anopheles gambiae


Alignment Length:37 Identity:19/37 - (51%)
Similarity:23/37 - (62%) Gaps:7/37 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   610 CPREFEPVCGSDNKTYLNDCFLEIENCRANQTVNVNY 646
            |||.:.||||:|.|||.|.|.|:   ||    :|.||
Mosquito    28 CPRSYRPVCGTDLKTYSNQCVLD---CR----INSNY 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:412159
KAZAL 220..266 CDD:197624
KAZAL_FS 326..>359 CDD:412159
KAZAL 380..430 CDD:197624
KAZAL 452..493 CDD:197624
KAZAL 502..>536 CDD:197624
KAZAL_FS 553..597 CDD:412159
KAZAL 606..650 CDD:197624 19/37 (51%)
LOC1278373XP_317819.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.