DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32354 and Fstl3

DIOPT Version :9

Sequence 1:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_446081.1 Gene:Fstl3 / 114031 RGDID:621811 Length:256 Species:Rattus norvegicus


Alignment Length:304 Identity:70/304 - (23%)
Similarity:107/304 - (35%) Gaps:109/304 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 VCGSDGNIYSSLCEL---KMLNCGPQRKSIQKVSMDKCKNRLTRCKQLPPCKDFNSLFGSIFSSK 457
            |.||..::...:|.|   |...|....|:  :||.::|            |..     |:|.::.
  Rat    24 VMGSGDSVPGGVCWLQQGKEATCSLVLKT--QVSREEC------------CAS-----GNINTAW 69

  Fly   458 RNDKLCGTDAKTYNNECELAHATCLRGVNLAHIGPCTDLNSPTKDCGDACTRADLEQQPVCGSDG 522
            .|....|       |:..|     |..:.|.|..||.| :....:||.......|..:|.|    
  Rat    70 SNFTHPG-------NKISL-----LGFLGLVHCLPCKD-SCDGVECGPGKACRMLGGRPHC---- 117

  Fly   523 NTFASMCEFKRRTCDLRVVPVSLKNCALTADCESDCDAQPPSF-VCGSDNNLYKSECHMRKENCG 586
                                          :|.|:|:..|..| |||||...|:.||.:|...|.
  Rat   118 ------------------------------ECVSNCEGVPAGFQVCGSDGATYRDECELRTARCR 152

  Fly   587 KH--VFVVPLKRCLAAFQLKGCAR-ICPR---------------------------EFEPVCGSD 621
            .|  :.|:...||     .|.||: :|||                           ..:.:||::
  Rat   153 GHPDLRVMYRGRC-----QKSCAQVVCPRPQSCLVDQTGSAHCVVCRAAPCPVPPNPGQELCGNN 212

  Fly   622 NKTYLNDCFLEIENCRANQTVNVNYYGAC-GRPEAPS---TNFL 661
            |.||::.|.|....|...:::.|.:.|.| |.|:.|:   .||:
  Rat   213 NVTYISSCHLRQATCFLGRSIGVRHPGICTGGPKVPAEEEENFV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:294071
KAZAL 220..266 CDD:197624
KAZAL_FS 326..>359 CDD:294071
KAZAL 380..430 CDD:197624 10/36 (28%)
KAZAL 452..493 CDD:197624 8/40 (20%)
KAZAL 502..>536 CDD:197624 5/33 (15%)
KAZAL_FS 553..597 CDD:294071 17/46 (37%)
KAZAL 606..650 CDD:197624 15/71 (21%)
Fstl3NP_446081.1 KAZAL 118..165 CDD:197624 17/46 (37%)
KAZAL_FS 198..241 CDD:238052 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.