DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32354 and FSTL1

DIOPT Version :9

Sequence 1:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_009016.1 Gene:FSTL1 / 11167 HGNCID:3972 Length:308 Species:Homo sapiens


Alignment Length:124 Identity:35/124 - (28%)
Similarity:51/124 - (41%) Gaps:33/124 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 VGAEPVCGSDGLIYANI-------CELRKK---TCSRSGVSLIKDVRDGCERSKGSDCKHRCSTE 228
            |.||....|...|.||:       |.:.:|   ||.                     |..:|...
Human    18 VRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCL---------------------CIEQCKPH 61

  Fly   229 KDPVCGTDGRTYLNRCMLRVQSCRVGLAAVKLSHVGPCSNTSAVRESC-PVDCNSAPKD 286
            |.||||::|:||||.|.|...:|..| :.:::.:.|.|....:|..|. ||.|..:.:|
Human    62 KRPVCGSNGKTYLNHCELHRDACLTG-SKIQVDYDGHCKEKKSVSPSASPVVCYQSNRD 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:294071 11/35 (31%)
KAZAL 220..266 CDD:197624 17/45 (38%)
KAZAL_FS 326..>359 CDD:294071
KAZAL 380..430 CDD:197624
KAZAL 452..493 CDD:197624
KAZAL 502..>536 CDD:197624
KAZAL_FS 553..597 CDD:294071
KAZAL 606..650 CDD:197624
FSTL1NP_009016.1 FOLN 31..53 CDD:128570 5/21 (24%)
KAZAL 54..98 CDD:197624 17/44 (39%)
EFh_SPARC_FSTL1 113..226 CDD:320012 2/7 (29%)
EF-hand motif 145..175 CDD:320012
EF-hand motif 194..224 CDD:320012
VWC 233..>271 CDD:327433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.