| Sequence 1: | NP_729380.1 | Gene: | CG32354 / 50302 | FlyBaseID: | FBgn0052354 | Length: | 662 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_005851.1 | Gene: | FSTL3 / 10272 | HGNCID: | 3973 | Length: | 263 | Species: | Homo sapiens |
| Alignment Length: | 204 | Identity: | 47/204 - (23%) |
|---|---|---|---|
| Similarity: | 69/204 - (33%) | Gaps: | 72/204 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 485 VNLAHIGPCTDLNSPTKDCGDACTRADLEQQPVCGSDGNTFASMCEFKRRTCDLRVVPVSLKNCA 549
Fly 550 LTADCESDCDAQPPSF-VCGSDNNLYKSECHMRKENCGKH--VFVVPLKRCLAAFQLKGCAR-IC 610
Fly 611 PR---------------------------EFEPVCGSDNKTYLNDCFLEIENCRANQTVNVNYYG 648
Fly 649 AC-GRPEAP 656 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32354 | NP_729380.1 | KAZAL_FS | 163..>200 | CDD:294071 | |
| KAZAL | 220..266 | CDD:197624 | |||
| KAZAL_FS | 326..>359 | CDD:294071 | |||
| KAZAL | 380..430 | CDD:197624 | |||
| KAZAL | 452..493 | CDD:197624 | 2/7 (29%) | ||
| KAZAL | 502..>536 | CDD:197624 | 5/33 (15%) | ||
| KAZAL_FS | 553..597 | CDD:294071 | 16/46 (35%) | ||
| KAZAL | 606..650 | CDD:197624 | 13/71 (18%) | ||
| FSTL3 | NP_005851.1 | KAZAL | 120..167 | CDD:197624 | 16/46 (35%) |
| KAZAL_FS | 171..>231 | CDD:294071 | 11/59 (19%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 242..263 | 5/9 (56%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3649 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||